Pseudomonas luteola: FOB45_03965 Help Entry FOB45_03965       CDS       T06601                                  Name (GenBank) hypothetical protein   KO K00286   pyrroline-5-carboxylate reductase [EC:1.5.1.2] Organism plul  Pseudomonas luteola Pathway plul00330   Arginine and proline metabolism plul01100   Metabolic pathways plul01110   Biosynthesis of secondary metabolites plul01230   Biosynthesis of amino acids Module plul_M00015   Proline biosynthesis, glutamate => proline Brite KEGG Orthology (KO) [BR:plul00001]  09100 Metabolism   09105 Amino acid metabolism    00330 Arginine and proline metabolism     FOB45_03965 Enzymes [BR:plul01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.2  pyrroline-5-carboxylate reductase      FOB45_03965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P5CR_dimer Motif Other DBs NCBI-ProteinID:  QEU26972 LinkDB All DBs Position 2:198468..198737 Genome browser AA seq 89 aa AA seqDB search MPALIREVLLAALKPELAKVLAAQTALGAALLQNQPGADFAALRTAVTSPNGTTAAAIAV FEQDRVLRGAVESATQAAYLRSQELSRDS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcctgcgctcattagagaggttttgttagcggctctaaaaccggaactcgctaaggtc ctggcggcacagacagccctcggtgctgcgcttttgcaaaaccaacctggagcggacttt gcagcactgcgcactgccgtaacctcacccaacggtaccacggcagcagcgattgcggtg ttcgagcaggaccgagtactacgaggcgcagtcgagtctgcgacccaggcggcatatctt cgctctcaagagctttctcgggactcctga

DBGET integrated database retrieval system