Parus major (Great Tit): 107200479 Help Entry 107200479         CDS       T04864                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism pmaj  Parus major (Great Tit) Pathway pmaj04140   Autophagy - animal pmaj04150   mTOR signaling pathway pmaj04218   Cellular senescence pmaj04910   Insulin signaling pathway pmaj05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pmaj00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     107200479 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107200479 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     107200479 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     107200479 (RHEB)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     107200479 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pmaj04031]     107200479 (RHEB) GTP-binding proteins [BR:pmaj04031]  Small (monomeric) G-proteins   Ras Family    Rheb     107200479 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 Motif Other DBs NCBI-GeneID:  107200479 NCBI-ProteinID:  XP_015474567 Ensembl:  ENSPMJG00000004916 LinkDB All DBs Position 2:complement(5844888..5883878) Genome browser AA seq 184 aa AA seqDB search MPPSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFKRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgccgtccaagtcccgcaagatcgcgatcctgggctaccggagcgtgggaaaatct tcactgacgatccagtttgtggaaggacagtttgttgattcatatgatccaaccatagag aacacttttacaaaactgatcacagtaaatggccaagaatatcatcttcagctggttgac actgctggccaggatgaatactccatatttcctcagacgtactccatagacatcaatggc tacattcttgtttattcagtcacgtcaataaaaagttttgaagtgataaaagttatccat ggcaagttattggatatggtgggaaaagtccaaatacccattatgctggttgggaataaa aaagacctgcatatggaacgggtgatcagctatgaagaagggaaagctttagcagaatcc tggaatgcagctttcttggaatcttctgctaaagaaaatcagactgccgttgatgttttt aagaggataattttggaggcagaaaaaatcgatggggcagcttcacaagggaagtcttca tgctcagtaatgtaa

DBGET integrated database retrieval system