Parus major (Great Tit): 107201076 Help Entry 107201076         CDS       T04864                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism pmaj  Parus major (Great Tit) Pathway pmaj04080   Neuroactive ligand-receptor interaction pmaj04920   Adipocytokine signaling pathway Brite KEGG Orthology (KO) [BR:pmaj00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     107201076 (NPY)  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     107201076 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pmaj04052]     107201076 (NPY) Cytokines and neuropeptides [BR:pmaj04052]  Neuropeptides   GPCR binding    107201076 (NPY) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  107201076 NCBI-ProteinID:  XP_015475751 Ensembl:  ENSPMJG00000000901 LinkDB All DBs Position 2:31895685..31904902 Genome browser AA seq 97 aa AA seqDB search MQGTVRLWVSVLTFALSLLVCLGTLAEAYPSKPDSPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPDTLISDLLLRESTENIPRSRFEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgcagggcaccgtgaggctgtgggtgtcggtgctgactttcgccctgtcgctgctggtc tgcctggggacgctggcagaggcgtacccctccaaaccggacagccccggcgaggacgcc cccgcagaggacatggccagatactactcggcgctgaggcactacatcaacctcatcacc cgacagagatatggaaagagatcaagcccagatacactgatctcagacctcttgttgagg gaaagcacagaaaacattcctagatccaggtttgaagacccttcgatgtggtga

DBGET integrated database retrieval system