Parus major (Great Tit): 107203241 Help Entry 107203241         CDS       T04864                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism pmaj  Parus major (Great Tit) Pathway pmaj04060   Cytokine-cytokine receptor interaction pmaj04218   Cellular senescence pmaj04620   Toll-like receptor signaling pathway pmaj04621   NOD-like receptor signaling pathway pmaj04622   RIG-I-like receptor signaling pathway pmaj05132   Salmonella infection pmaj05164   Influenza A Brite KEGG Orthology (KO) [BR:pmaj00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107203241  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107203241  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107203241    04621 NOD-like receptor signaling pathway     107203241    04622 RIG-I-like receptor signaling pathway     107203241  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     107203241   09171 Infectious disease: bacterial    05132 Salmonella infection     107203241  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pmaj04052]     107203241    00536 Glycosaminoglycan binding proteins [BR:pmaj00536]     107203241 Cytokines and neuropeptides [BR:pmaj04052]  Cytokines   Chemokines    107203241 Glycosaminoglycan binding proteins [BR:pmaj00536]  Heparan sulfate / Heparin   Chemokines    107203241 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  107203241 NCBI-ProteinID:  XP_015480523 LinkDB All DBs Position 4:1513826..1516717 Genome browser AA seq 128 aa AA seqDB search MDGKSVAVALVLYLVSMAGSEGKALEKTDERGSQCRCISTHSKFIPPKTIQDVRLSRRGP HCKNVEIIATLKDGREVCVEPAAPWIQLTVKALLARARDNVESPVKEKSRKNKPWISASI GNERKHCC NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggatggcaaatctgttgctgtcgctttggttctctacttggtctcaatggcagggtca gaaggtaaggccctggagaagacagatgaaagaggctcccaatgccggtgcataagcaca cattccaagttcatccctcccaagactattcaggatgtgagattaagccgaagaggacct cactgcaaaaatgtggaaatcatagctacgctgaaagatggcagggaagtgtgcgtggaa cctgctgcgccctggatccagctcactgtaaaggctctgctggccagggccagggacaat gttgagtcaccagtcaaagaaaagtcaaggaagaacaaaccttggatttctgcaagcata ggaaatgagagaaaacattgctgctga

DBGET integrated database retrieval system