Parus major (Great Tit): 107203242 Help Entry 107203242         CDS       T04864                                  Name (RefSeq) interleukin-8-like isoform X2   KO K10030   interleukin 8 Organism pmaj  Parus major (Great Tit) Pathway pmaj04060   Cytokine-cytokine receptor interaction pmaj04218   Cellular senescence pmaj04620   Toll-like receptor signaling pathway pmaj04621   NOD-like receptor signaling pathway pmaj04622   RIG-I-like receptor signaling pathway pmaj05132   Salmonella infection pmaj05164   Influenza A Brite KEGG Orthology (KO) [BR:pmaj00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107203242  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107203242  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107203242    04621 NOD-like receptor signaling pathway     107203242    04622 RIG-I-like receptor signaling pathway     107203242  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     107203242   09171 Infectious disease: bacterial    05132 Salmonella infection     107203242  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pmaj04052]     107203242    00536 Glycosaminoglycan binding proteins [BR:pmaj00536]     107203242 Cytokines and neuropeptides [BR:pmaj04052]  Cytokines   Chemokines    107203242 Glycosaminoglycan binding proteins [BR:pmaj00536]  Heparan sulfate / Heparin   Chemokines    107203242 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  107203242 NCBI-ProteinID:  XP_015480525 Ensembl:  ENSPMJG00000000482 LinkDB All DBs Position 4:1506829..1511538 Genome browser AA seq 104 aa AA seqDB search MIAKTVAAVLLLLLISALGTRAEAVPRSAIELRCQCISTHSKFIHPKFIQNVNLTPSGPH CKNVEVIATLRDGREVCLEPTAPWVKLIIKTILDKANSKSETVS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgattgccaagactgtggctgctgtcctgctcctgctcctgatctcagcgcttggaaca cgagctgaggcagtgccacgctcggccattgaactccggtgccagtgcataagcacccat tccaagttcatccatcccaagttcatccaaaacgtgaacctcacccccagcggacctcac tgcaagaatgttgaagtcatagctaccctgagagatggcagagaagtgtgcctggagccc actgctccctgggtgaagctgatcatcaagacaattctggacaaggccaacagcaaatct gagacagtgtcctaa

DBGET integrated database retrieval system