Parus major (Great Tit): 107204161 Help Entry 107204161         CDS       T04864                                  Symbol TUBAL3 Name (RefSeq) tubulin alpha chain-like 3   KO K07374   tubulin alpha Organism pmaj  Parus major (Great Tit) Pathway pmaj04145   Phagosome pmaj04210   Apoptosis pmaj04530   Tight junction pmaj04540   Gap junction pmaj04814   Motor proteins pmaj05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmaj00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107204161 (TUBAL3)   09143 Cell growth and death    04210 Apoptosis     107204161 (TUBAL3)   09144 Cellular community - eukaryotes    04530 Tight junction     107204161 (TUBAL3)    04540 Gap junction     107204161 (TUBAL3)   09142 Cell motility    04814 Motor proteins     107204161 (TUBAL3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107204161 (TUBAL3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pmaj03019]     107204161 (TUBAL3)    03036 Chromosome and associated proteins [BR:pmaj03036]     107204161 (TUBAL3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pmaj04812]     107204161 (TUBAL3)    04147 Exosome [BR:pmaj04147]     107204161 (TUBAL3) Messenger RNA biogenesis [BR:pmaj03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      107204161 (TUBAL3) Chromosome and associated proteins [BR:pmaj03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      107204161 (TUBAL3) Cytoskeleton proteins [BR:pmaj04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     107204161 (TUBAL3) Exosome [BR:pmaj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107204161 (TUBAL3)   Exosomal proteins of other body fluids (saliva and urine)    107204161 (TUBAL3)   Exosomal proteins of colorectal cancer cells    107204161 (TUBAL3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tubulin Motif Other DBs NCBI-GeneID:  107204161 NCBI-ProteinID:  XP_033370613 LinkDB All DBs Position 1A:complement(573173..578290) Genome browser AA seq 95 aa AA seqDB search MRECISIHIGQAGVQMGNACWELYCLEHGIQADGTIPGSKQVKSMDPNSEQVDSSFETFF CETASGKHVPRAVFIDLEPTVIGKTQILPLIRLYP NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgagggagtgcatttccatccacatcgggcaggccggagtgcagatgggcaatgcctgc tgggagctctactgcctggagcacggcatccaggccgacgggaccattcccggctccaag caggtgaaatccatggatcccaactccgagcaggtggattcctccttcgagaccttcttc tgtgagacagcatctggcaaacacgtgccccgggcggtgttcatagacctggagcccact gtcattggtaaaacccagattttgcccctgatccgtctttatccctaa

DBGET integrated database retrieval system