Parus major (Great Tit): 107204237 Help Entry 107204237         CDS       T04864                                  Name (RefSeq) calmodulin, striated muscle   KO K02183   calmodulin Organism pmaj  Parus major (Great Tit) Pathway pmaj04020   Calcium signaling pathway pmaj04070   Phosphatidylinositol signaling system pmaj04114   Oocyte meiosis pmaj04218   Cellular senescence pmaj04261   Adrenergic signaling in cardiomyocytes pmaj04270   Vascular smooth muscle contraction pmaj04371   Apelin signaling pathway pmaj04625   C-type lectin receptor signaling pathway pmaj04744   Phototransduction pmaj04910   Insulin signaling pathway pmaj04912   GnRH signaling pathway pmaj04916   Melanogenesis Brite KEGG Orthology (KO) [BR:pmaj00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     107204237    04020 Calcium signaling pathway     107204237    04070 Phosphatidylinositol signaling system     107204237  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     107204237    04218 Cellular senescence     107204237  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107204237   09152 Endocrine system    04910 Insulin signaling pathway     107204237    04912 GnRH signaling pathway     107204237    04916 Melanogenesis     107204237   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     107204237    04270 Vascular smooth muscle contraction     107204237   09157 Sensory system    04744 Phototransduction     107204237  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pmaj01009]     107204237   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmaj04131]     107204237    03036 Chromosome and associated proteins [BR:pmaj03036]     107204237   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmaj04147]     107204237 Protein phosphatases and associated proteins [BR:pmaj01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      107204237 Membrane trafficking [BR:pmaj04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     107204237 Chromosome and associated proteins [BR:pmaj03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      107204237 Exosome [BR:pmaj04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107204237 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH EF-hand_11 SPARC_Ca_bdg EFhand_Ca_insen Dockerin_1 UPF0154 Caleosin DUF5580_M FCaBP_EF-hand SPEF2_C SurA_N_2 SurA_N_3 Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  107204237 NCBI-ProteinID:  XP_015482577 Ensembl:  ENSPMJG00000013093 LinkDB All DBs Position 1A:640257..641780 Genome browser AA seq 149 aa AA seqDB search MAERLSEEKIAEFKEAFSLFDRDGDGCITTKELGTVMRSLGQNPTEAELQDMVGELDADG SGTVDFPEFLSLMARKMRDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIKEADCNNDGQVNYEEFVRMMTEK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgagcggctgtcggaggagaaaatcgcggaattcaaggaagctttttccctcttt gaccgcgacggcgacggctgcatcaccaccaaggagctgggcaccgtcatgcgctcgctg ggccagaaccccaccgaggccgagctccaggacatggtgggcgagctggacgccgacggc agcggcaccgtggacttcccagagttcctgtcgctgatggcgaggaagatgagggacacg gacagcgaggaggagatccgcgaggcgttccgggtcttcgacaaggatggcaacggctac atcagcgcggccgagctgcggcacgtcatgaccaacctgggcgagaagctgacggacgag gaggtggacgagatgatcaaggaggccgattgcaacaacgacgggcaggtcaactacgag gagttcgtgaggatgatgacggagaagtga

DBGET integrated database retrieval system