Parus major (Great Tit): 107204305 Help Entry 107204305         CDS       T04864                                  Name (RefSeq) histone H2B 1/2   KO K11252   histone H2B Organism pmaj  Parus major (Great Tit) Brite KEGG Orthology (KO) [BR:pmaj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pmaj03036]     107204305   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmaj04147]     107204305 Chromosome and associated proteins [BR:pmaj03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107204305 Exosome [BR:pmaj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107204305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa LonB_AAA-LID Motif Other DBs NCBI-GeneID:  107204305 NCBI-ProteinID:  XP_015482673 LinkDB All DBs Position 1A:45754822..45755728 Genome browser AA seq 67 aa AA seqDB search MGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaggcgtcg cgcctggcgcactacaacaagcgctccaccatcacgtcgcgggagatccagacggccgtg cggctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggctgtc accaagtacaccagctccaagtaa

DBGET integrated database retrieval system