Parus major (Great Tit): 107206312 Help Entry 107206312         CDS       T04864                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism pmaj  Parus major (Great Tit) Pathway pmaj03030   DNA replication pmaj03410   Base excision repair pmaj03420   Nucleotide excision repair pmaj03430   Mismatch repair pmaj03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pmaj00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     107206312 (POLD4)    03410 Base excision repair     107206312 (POLD4)    03420 Nucleotide excision repair     107206312 (POLD4)    03430 Mismatch repair     107206312 (POLD4)    03440 Homologous recombination     107206312 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pmaj03032]     107206312 (POLD4)    03400 DNA repair and recombination proteins [BR:pmaj03400]     107206312 (POLD4) DNA replication proteins [BR:pmaj03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     107206312 (POLD4) DNA repair and recombination proteins [BR:pmaj03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       107206312 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      107206312 (POLD4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  107206312 NCBI-ProteinID:  XP_015487547 LinkDB All DBs Position 5:7097026..7098197 Genome browser AA seq 122 aa AA seqDB search MSRRVMEQPRRITDSFPRRRRRGPGRLPGRLKDKKNKDKVQVKVRDCPRAPSQPTPDPAL LEMLRRFDLSWEYGPCSGITRLQRWERAQELGLSPPGPIRDALLEYRDNPDVTYSLWHEY DL NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgtcgcgcagggtaatggagcagccccggcgcatcaccgactccttcccgcggcggcgg cggcggggccctgggcgactcccgggcaggctcaaggacaagaagaacaaggacaaggtg caggtgaaggtgcgggactgtcctcgcgccccctcgcagcccaccccggacccggcgctc ctggagatgttgcggcgcttcgatctctcctgggaatacggaccctgcagcgggatcacc cgcctgcagcgctgggagcgagcacaagagctggggctgagcccccctggccccatccgt gacgccctcctggagtaccgggacaaccccgatgtcacctacagcctctggcacgagtat gatctctga

DBGET integrated database retrieval system