Parus major (Great Tit): 107206741 Help Entry 107206741         CDS       T04864                                  Symbol BBIP1 Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism pmaj  Parus major (Great Tit) Brite KEGG Orthology (KO) [BR:pmaj00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pmaj03037]     107206741 (BBIP1) Cilium and associated proteins [BR:pmaj03037]  Primary cilia and associated proteins   BBSome    107206741 (BBIP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  107206741 NCBI-ProteinID:  XP_015488321 Ensembl:  ENSPMJG00000005209 LinkDB All DBs Position 6:complement(24761195..24769553) Genome browser AA seq 73 aa AA seqDB search MPEGTGALREVLPKQGQLSMEDTPAMVLCKPKILPLKSVSLEKLEKLQKAALEAAQPPES APPPSAGTAPPRQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgccggaggggacgggagcgctccgggaggtgctgcccaagcaagggcagctgtcgatg gaggacacgcccgccatggtgctgtgcaagcccaagatcctgcccctcaagtcggtgtcg ctggagaagctggagaagctgcagaaggcggcgctggaggcggcccagccgcccgagtcg gccccgccgccgtctgcggggaccgcgccgccccggcagtag

DBGET integrated database retrieval system