Parus major (Great Tit): 107210304 Help Entry 107210304         CDS       T04864                                  Name (RefSeq) histone H2A type 2-B   KO K11251   histone H2A Organism pmaj  Parus major (Great Tit) Pathway pmaj03082   ATP-dependent chromatin remodeling pmaj04217   Necroptosis Brite KEGG Orthology (KO) [BR:pmaj00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     107210304  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     107210304  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pmaj03036]     107210304   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmaj04147]     107210304 Chromosome and associated proteins [BR:pmaj03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107210304 Exosome [BR:pmaj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107210304 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  107210304 NCBI-ProteinID:  XP_015496443 LinkDB All DBs Position 12:8770587..8772963 Genome browser AA seq 126 aa AA seqDB search MSGRGKSGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLS AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TQSSKK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgtcgggccggggaaagtccggcggaaaggcgcgggccaaggccaagtcgcgctcgtcg cgggccgggctgcagttccccgtggggcgggtgcaccggctgctgcggaagggtaactac gcggagcgggtgggcgccggggcgccggtgtacctggcggccgtgctggagtacctgtcg gctgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcggcacctgcagctcgccatccgcaacgacgaggagctcaacaagctgctgggcggc gtgaccatcgcccagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag acgcagagctccaagaagtga

DBGET integrated database retrieval system