Parus major (Great Tit): 107210352 Help Entry 107210352         CDS       T04864                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism pmaj  Parus major (Great Tit) Pathway pmaj04081   Hormone signaling pmaj04144   Endocytosis pmaj04150   mTOR signaling pathway pmaj04270   Vascular smooth muscle contraction pmaj04310   Wnt signaling pathway pmaj04350   TGF-beta signaling pathway pmaj04510   Focal adhesion pmaj04520   Adherens junction pmaj04530   Tight junction pmaj04621   NOD-like receptor signaling pathway pmaj04625   C-type lectin receptor signaling pathway pmaj04810   Regulation of actin cytoskeleton pmaj05100   Bacterial invasion of epithelial cells pmaj05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmaj00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     107210352 (RHOA)    04350 TGF-beta signaling pathway     107210352 (RHOA)    04150 mTOR signaling pathway     107210352 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     107210352 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107210352 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     107210352 (RHOA)    04520 Adherens junction     107210352 (RHOA)    04530 Tight junction     107210352 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     107210352 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     107210352 (RHOA)    04625 C-type lectin receptor signaling pathway     107210352 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     107210352 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107210352 (RHOA)    05100 Bacterial invasion of epithelial cells     107210352 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmaj04131]     107210352 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmaj04147]     107210352 (RHOA)    04031 GTP-binding proteins [BR:pmaj04031]     107210352 (RHOA) Membrane trafficking [BR:pmaj04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     107210352 (RHOA) Exosome [BR:pmaj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107210352 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    107210352 (RHOA)   Exosomal proteins of colorectal cancer cells    107210352 (RHOA)   Exosomal proteins of bladder cancer cells    107210352 (RHOA) GTP-binding proteins [BR:pmaj04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     107210352 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  107210352 NCBI-ProteinID:  XP_015496578 Ensembl:  ENSPMJG00000012555 LinkDB All DBs Position 12:6439093..6462589 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggagatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aattacgtagcagatattgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaggaagactacgatcgacttagaccgctttcctatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggacc ccggaggtgaagcatttctgccccaacgtgcctatcatcctggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cccgaggaaggccgggatatggcaaaccgcattggtgcattcgggtacatggagtgttcg gcaaagaccaaagacggtgtgagggaggtgtttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system