Parus major (Great Tit): 107216112 Help Entry 107216112         CDS       T04864                                  Symbol TXN Name (RefSeq) thioredoxin isoform X2   KO K03671   thioredoxin Organism pmaj  Parus major (Great Tit) Pathway pmaj04621   NOD-like receptor signaling pathway pmaj05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmaj00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     107216112 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107216112 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pmaj03110]     107216112 (TXN) Chaperones and folding catalysts [BR:pmaj03110]  Protein folding catalysts   Protein disulfide isomerase    107216112 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 AhpC-TSA DIM1 OST3_OST6 Glutaredoxin Thioredoxin_7 Thioredoxin_9 DUF6568 Redoxin Motif Other DBs NCBI-GeneID:  107216112 NCBI-ProteinID:  XP_015508171 Ensembl:  ENSPMJG00000005083 LinkDB All DBs Position Z:50826174..50835276 Genome browser AA seq 105 aa AA seqDB search MVKIVGSLVEFEEELKSAGEKLIVVDFSATWCGPCKMIKPFFHSLCEKYGDVVFIEIDVD DAQDVASHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSLV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagatcgtgggtagcttggttgaatttgaggaagaactgaaatctgctggtgag aagcttatagtagttgatttctctgccacatggtgtggaccctgcaaaatgatcaagccg tttttccacagtttgtgtgagaagtatggtgatgtggtgttcatagaaattgatgtggat gatgcccaggatgttgcttcacactgtgatgtgaagtgcatgccgacgttccagttctac aagaatggaaagaaggtgcaggagttctctggggccaataaagagaagctggaagagact attaaaagtctagtctaa

DBGET integrated database retrieval system