Parus major (Great Tit): 107216224 Help Entry 107216224         CDS       T04864                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism pmaj  Parus major (Great Tit) Pathway pmaj04068   FoxO signaling pathway pmaj04136   Autophagy - other pmaj04140   Autophagy - animal pmaj04621   NOD-like receptor signaling pathway pmaj04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:pmaj00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     107216224 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107216224 (ATG12)    04136 Autophagy - other     107216224 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     107216224 (ATG12)    04622 RIG-I-like receptor signaling pathway     107216224 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmaj04131]     107216224 (ATG12)    04121 Ubiquitin system [BR:pmaj04121]     107216224 (ATG12)    03029 Mitochondrial biogenesis [BR:pmaj03029]     107216224 (ATG12) Membrane trafficking [BR:pmaj04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     107216224 (ATG12) Ubiquitin system [BR:pmaj04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    107216224 (ATG12) Mitochondrial biogenesis [BR:pmaj03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     107216224 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  107216224 NCBI-ProteinID:  XP_015508477 LinkDB All DBs Position Z:complement(52531225..52534674) Genome browser AA seq 143 aa AA seqDB search MAELEEQAPPAAVQSTGRSDGGEETSEGGAATSPPEPGPPPAGSPGTEESAGDAKKKIDV LLKAVGDTPIMRTKKWAVERTRTIQGLVDFIKKFLKLMASEQLFIYVNQSFAPSPDQEVG TLYECFGSDGKLVLHYCKTQAWG NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggcggagctcgaggagcaggcgccgcccgccgcggtgcagagcaccggccggagcgac ggcggagaggagacctcggagggcggagcagcgacgagcccccccgaaccaggcccgccc ccggccgggtcgccaggcaccgaggagtccgcgggcgacgctaaaaagaaaattgatgtg ctgctgaaggctgtgggcgacacccccatcatgaggaccaagaaatgggcggtggagcgg acccggaccatccagggcctcgtggacttcatcaaaaagttcctcaagctgatggcctcc gaacagctgttcatatatgttaaccagtcttttgctccatctccagaccaagaagtgggg accctctatgagtgttttggaagtgatggcaagcttgtactgcattattgcaaaactcag gcttggggatga

DBGET integrated database retrieval system