Planococcus sp. Y42: B0X71_13870 Help Entry B0X71_13870       CDS       T04763                                  Name (GenBank) hypothetical protein   KO K07260   zinc D-Ala-D-Ala carboxypeptidase [EC:3.4.17.14] Organism pmar  Planococcus sp. Y42 Pathway pmar00550   Peptidoglycan biosynthesis pmar01100   Metabolic pathways pmar01502   Vancomycin resistance pmar02020   Two-component system Brite KEGG Orthology (KO) [BR:pmar00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00550 Peptidoglycan biosynthesis     B0X71_13870  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     B0X71_13870  09160 Human Diseases   09175 Drug resistance: antimicrobial    01502 Vancomycin resistance     B0X71_13870  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pmar01002]     B0X71_13870    01011 Peptidoglycan biosynthesis and degradation proteins [BR:pmar01011]     B0X71_13870   09183 Protein families: signaling and cellular processes    01504 Antimicrobial resistance genes [BR:pmar01504]     B0X71_13870 Enzymes [BR:pmar01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.17  Metallocarboxypeptidases     3.4.17.14  zinc D-Ala-D-Ala carboxypeptidase      B0X71_13870 Peptidases and inhibitors [BR:pmar01002]  Metallo peptidases   Family M15: zinc D-Ala-D-Ala carboxypeptidase family    B0X71_13870 Peptidoglycan biosynthesis and degradation proteins [BR:pmar01011]  Peptidoglycan biosynthesis and degradation   Carboxypeptidase    B0X71_13870 Antimicrobial resistance genes [BR:pmar01504]  Gene sets   Vancomycin resistance modules    Vancomycin resistance, D-Ala-D-Lac type [MD:M00651]     B0X71_13870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  VanY MrcB_N Motif Other DBs NCBI-ProteinID:  AQQ54082 UniProt:  A0A1Q2L2H2 LinkDB All DBs Position complement(2703105..2703398) Genome browser AA seq 97 aa AA seqDB search MSKSPGLGTVKLNLLDLLPSAYNPGVTPVAQKGVDAMIAAAKKQGVYLTMFSGFRAYERQ KALYNNYVQQYGKTAAERFSACPGHSEHQSGLAFDLA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt ttgtcaaaatcacctggtttgggcacagtgaaattaaaccttttagaccttttgccatcg gcgtataatccgggcgttactcccgtggcacaaaaaggcgtcgatgccatgattgccgca gcaaaaaaacagggggtctatttgacgatgttcagcggattccgggcctatgagcggcag aaggcgctgtacaataattatgtccagcaatacggcaagacagctgccgaacggttcagc gcatgtcccggccatagtgaacaccagagcggcctggcgttcgatctggcttaa

DBGET integrated database retrieval system