Poecilia mexicana (shortfin molly): 106930037 Help Entry 106930037         CDS       T08022                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei03030   DNA replication pmei03410   Base excision repair pmei03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pmei00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     106930037 (pole4)    03410 Base excision repair     106930037 (pole4)    03420 Nucleotide excision repair     106930037 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pmei03032]     106930037 (pole4)    03400 DNA repair and recombination proteins [BR:pmei03400]     106930037 (pole4) Enzymes [BR:pmei01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      106930037 (pole4) DNA replication proteins [BR:pmei03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     106930037 (pole4) DNA repair and recombination proteins [BR:pmei03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       106930037 (pole4) SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  106930037 NCBI-ProteinID:  XP_014862868 Ensembl:  ENSPMEG00000015891 UniProt:  A0A3B3XF21 LinkDB All DBs Position Unknown AA seq 131 aa AA seqDB search MAATVEAPVPAEQDSARCGTEEENRGAEVEEKSQQQQQQTSSTGPAVPHSRLSKLPLARI KALMKTDPDVSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAI DEFAFLEGTLD NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggcagctactgtagaagcgcctgtcccagcggagcaggactctgcgcggtgcgggact gaggaggagaaccgcggggcggaggtggaggagaagagccagcagcagcagcagcagaca tcctccaccgggcccgccgttcctcacagccgtctgtccaaactccctctggcccgcatc aaagctctgatgaagaccgacccagacgtgtccctcgccagccaagagtccgtgttcatc atcgctaaagccacggaattgtttgttgagatgattgccaaagacgctcttgtgtacgcc cagcaaggaaagaggaaaacattacaaagaaaagacttggacaatgctattgaggccata gatgagtttgctttcctagaaggtacgctagattaa

DBGET integrated database retrieval system