Poecilia mexicana (shortfin molly): 106930562 Help Entry 106930562         CDS       T08022                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei03420   Nucleotide excision repair pmei04110   Cell cycle pmei04114   Oocyte meiosis pmei04120   Ubiquitin mediated proteolysis pmei04141   Protein processing in endoplasmic reticulum pmei04310   Wnt signaling pathway pmei04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:pmei00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106930562 (rbx1)    04120 Ubiquitin mediated proteolysis     106930562 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     106930562 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     106930562 (rbx1)    04350 TGF-beta signaling pathway     106930562 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     106930562 (rbx1)    04114 Oocyte meiosis     106930562 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pmei04121]     106930562 (rbx1)    03400 DNA repair and recombination proteins [BR:pmei03400]     106930562 (rbx1) Enzymes [BR:pmei01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      106930562 (rbx1) Ubiquitin system [BR:pmei04121]  Ubiquitin ligases (E3)   UBL E3 ligases    106930562 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      106930562 (rbx1)    Cul2 complex      106930562 (rbx1)    Cul3 complex      106930562 (rbx1)    Cul4 complex      106930562 (rbx1)    Cul7 complex      106930562 (rbx1)    Cul8 complex      106930562 (rbx1)    Cul9 complex      106930562 (rbx1) DNA repair and recombination proteins [BR:pmei03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       106930562 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       106930562 (rbx1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  106930562 NCBI-ProteinID:  XP_014863681 Ensembl:  ENSPMEG00000018021 UniProt:  A0A3B3XK02 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcagcgatggatgttgacacaccaagcggtactaacagtggagctagcaagaaa cgcttcgaagtcaaaaagtggaacgctgttgcgctgtgggcctgggacatagtggtggat aattgtgccatctgtaggaaccacatcatggatctctgtatagagtgtcaggccaaccag gcgtctgcgacgtcggaagagtgcaccgtagcctggggggtctgcaatcatgcttttcat tttcactgtatttcccgctggctgaaaaccagacaggtgtgtcctctggacaacagagag tgggagttccagaaatacggacactag

DBGET integrated database retrieval system