Paramacrobiotus metropolitanus: 129581069 Help Entry 129581069         CDS       T09028                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism pmeo  Paramacrobiotus metropolitanus Pathway pmeo00510   N-Glycan biosynthesis pmeo00513   Various types of N-glycan biosynthesis pmeo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pmeo00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     129581069    00513 Various types of N-glycan biosynthesis     129581069  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     129581069 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Claudin_3 DUF7027 Motif Other DBs NCBI-GeneID:  129581069 NCBI-ProteinID:  XP_055327908 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MEIPKSEFFDVSTYSRYSGPVDAAIIPLMSYLLLGAGFFFMAYFFVYEVTSTKSSRELRK EILVATLAALFLGVGTVFALLLVGIYV NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaaataccgaaatccgaattttttgatgtgtcgacatattcacgatattccggccct gtcgatgctgccatcataccgctgatgtcgtatctgctgctgggcgccgggtttttcttc atggcttatttcttcgtgtacgaagtgacatctacgaaatcttcgcgagaactgcggaag gagattttggttgccactttggccgctctgtttttaggagttggcacagttttcgccctt ctgcttgttggaatatacgtttaa

DBGET integrated database retrieval system