Passer montanus (Eurasian tree sparrow): 120503678 Help Entry 120503678         CDS       T07277                                  Name (RefSeq) hepatic lectin-like isoform X1   KO K06563   C-type lectin domain family 4 member L/M Organism pmoa  Passer montanus (Eurasian tree sparrow) Pathway pmoa03260   Virion - Human immunodeficiency virus pmoa03264   Virion - Flavivirus and Alphavirus pmoa03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus pmoa03273   Virion - Lassa virus and SFTS virus pmoa04145   Phagosome pmoa04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:pmoa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     120503678    03264 Virion - Flavivirus and Alphavirus     120503678    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     120503678    03273 Virion - Lassa virus and SFTS virus     120503678  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     120503678  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120503678  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmoa04131]     120503678   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:pmoa04054]     120503678    04090 CD molecules [BR:pmoa04090]     120503678    04091 Lectins [BR:pmoa04091]     120503678 Membrane trafficking [BR:pmoa04131]  Endocytosis   Phagocytosis    C-lectin receptors     120503678 Pattern recognition receptors [BR:pmoa04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    120503678 CD molecules [BR:pmoa04090]  Proteins   120503678 Lectins [BR:pmoa04091]  C-Type lectins   Asialoglycoprotein and DC receptors    120503678 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  120503678 NCBI-ProteinID:  XP_039568329 LinkDB All DBs Position Unknown AA seq 212 aa AA seqDB search MDEEELQDDLRLFPGGAALPARLRSFPAVYLSLALSSLLLLGLSALALARVSSISSKLHQ ESPEWNFSSWDSFLFPCGADSREWEYFSGNCYYFSLARLSWERAREQCRERRARLAVVGS FAEQQFLMSRTRNERFWIGLTDRNSEGNWEWVDGTDYKSSFTFWREGEPNDSGSNEDCAH LWISGKWNDVHCTFECFFVCERPLSQKSPFSH NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atggacgaggaggagctccaggatgacctgcgcctcttcccaggcggcgcggcgctcccg gcgcggctccgctccttcccggccgtgtacctgagcctggcgctctcctcgctgctgctg ctgggcctcagcgccctggcgctggccagagtttcctccatttcctccaaactccaccag gagagtccggagtggaatttttccagctgggattccttcctgttcccgtgcggggcggat tcccgggaatgggaatatttttctgggaattgttattatttctcgctggcgcggctgagc tgggagcgggcgcgggagcagtgccgggagcgccgcgcccgcctggccgtggtcggcagc ttcgccgagcagcagttcctgatgtcccgcacgcggaacgagcgcttctggatcgggctc accgaccggaattccgagggaaactgggaatgggtcgacggcaccgactacaaatcctcc ttcacgttttggcgtgagggggagcccaacgacagcgggagtaacgaggattgcgctcac ctctggatctccgggaagtggaacgacgtccactgcaccttcgagtgcttcttcgtctgc gagcgccccctttcccaaaaatcccctttttcccactaa

DBGET integrated database retrieval system