Passer montanus (Eurasian tree sparrow): 120510088 Help Entry 120510088         CDS       T07277                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pmoa  Passer montanus (Eurasian tree sparrow) Pathway pmoa03420   Nucleotide excision repair pmoa04110   Cell cycle pmoa04114   Oocyte meiosis pmoa04120   Ubiquitin mediated proteolysis pmoa04141   Protein processing in endoplasmic reticulum pmoa04310   Wnt signaling pathway pmoa04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:pmoa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120510088 (RBX1)    04120 Ubiquitin mediated proteolysis     120510088 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     120510088 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     120510088 (RBX1)    04350 TGF-beta signaling pathway     120510088 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pmoa04121]     120510088 (RBX1)    03400 DNA repair and recombination proteins [BR:pmoa03400]     120510088 (RBX1) Enzymes [BR:pmoa01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      120510088 (RBX1) Ubiquitin system [BR:pmoa04121]  Ubiquitin ligases (E3)   UBL E3 ligases    120510088 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      120510088 (RBX1)    Cul2 complex      120510088 (RBX1)    Cul3 complex      120510088 (RBX1)    Cul4 complex      120510088 (RBX1)    Cul7 complex      120510088 (RBX1)    Cul8 complex      120510088 (RBX1)    Cul9 complex      120510088 (RBX1) DNA repair and recombination proteins [BR:pmoa03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       120510088 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       120510088 (RBX1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  120510088 NCBI-ProteinID:  XP_039581472 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcaatggatgtggatacccccagcggaaccaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaacgccgtggctctgtgggcatgggacattgtggttgat aactgtgccatttgcagaaaccacatcatggatctatgcatagaatgtcaagccaaccaa gcatcggctacctctgaggagtgcacagttgcatggggagtctgcaatcacgctttccac ttccactgcatctctcgctggctcaaaactcgccaagtatgtccgctggacaacagggaa tgggagttccaaaagtatggacactag

DBGET integrated database retrieval system