Passer montanus (Eurasian tree sparrow): 120510412 Help Entry 120510412         CDS       T07277                                  Name (RefSeq) cellular tumor antigen p53-like   KO K04451   tumor protein p53 Organism pmoa  Passer montanus (Eurasian tree sparrow) Pathway pmoa04010   MAPK signaling pathway pmoa04110   Cell cycle pmoa04115   p53 signaling pathway pmoa04137   Mitophagy - animal pmoa04210   Apoptosis pmoa04216   Ferroptosis pmoa04218   Cellular senescence pmoa04310   Wnt signaling pathway pmoa05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pmoa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120510412    04310 Wnt signaling pathway     120510412  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     120510412   09143 Cell growth and death    04110 Cell cycle     120510412    04210 Apoptosis     120510412    04216 Ferroptosis     120510412    04115 p53 signaling pathway     120510412    04218 Cellular senescence     120510412  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     120510412  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pmoa03000]     120510412    03036 Chromosome and associated proteins [BR:pmoa03036]     120510412    03400 DNA repair and recombination proteins [BR:pmoa03400]     120510412 Transcription factors [BR:pmoa03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     120510412 Chromosome and associated proteins [BR:pmoa03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      120510412 DNA repair and recombination proteins [BR:pmoa03400]  Eukaryotic type   Check point factors    Other check point factors     120510412 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer Motif Other DBs NCBI-GeneID:  120510412 NCBI-ProteinID:  XP_039582149 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search GFGFNFGFFGVPPGNAPPQHLIRVEGNPQARYQDDETTKRHSVAVPYEPPEVGSECTTVL YNFMCNSSCMGGMNRRPILTILTLEAPGGQILGRRCFEVRVCACPGRDRRHEEETQRKRG GAGGGAKRALSPLAEAPESSKKRLQDPENEIFYLQVRGRQRYEMFRMVNEALEHTYGGGA APRK NT seq 557 nt NT seq  +upstreamnt  +downstreamnt ttggttttgggtttaattttggattttttggggtccccccaggcaacgcccccccccagc acctgatccgggtggaggggaacccccaggcccggtaccaggacgatgagaccaccaaga gacacagcgtggccgtgccctacgagccccccgaggtgggctcggagtgcaccacggtcc tgtacaacttcatgtgcaacagctcctgcatggggggcatgaacaggagacccatcctca ccatcctcaccctggaggcgccggggggtcagattttgggccggcgctgtttcgaggtgc gcgtctgcgcctgcccgggccgggaccggcgccacgaggaggagacccagcgcaagaggg gcggggccgggggcggggccaagcgagccctgtcccccctggccgaagcccccgagagct ccaagaagaggctgcaggaccccgagaacgagatcttctacctgcaggtgcggggccggc agcgctacgagatgttccgcatggtgaacgaggccctggagcacacctacggggggggcg cggccccccgaaagtga

DBGET integrated database retrieval system