KEGG   Pseudomonas monteilii SB3101: X970_10605
Entry
X970_10605        CDS       T02973                                 
Name
(GenBank) 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
  KO
K16269  cis-1,2-dihydrobenzene-1,2-diol/chlorobenzene dihydrodiol dehydrogenase [EC:1.3.1.19 1.3.1.119]
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
pmot00361  Chlorocyclohexane and chlorobenzene degradation
pmot00362  Benzoate degradation
pmot00623  Toluene degradation
pmot00624  Polycyclic aromatic hydrocarbon degradation
pmot00643  Styrene degradation
pmot01100  Metabolic pathways
pmot01120  Microbial metabolism in diverse environments
pmot01220  Degradation of aromatic compounds
Module
pmot_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:pmot00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X970_10605
   00361 Chlorocyclohexane and chlorobenzene degradation
    X970_10605
   00623 Toluene degradation
    X970_10605
   00643 Styrene degradation
    X970_10605
   00624 Polycyclic aromatic hydrocarbon degradation
    X970_10605
Enzymes [BR:pmot01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.19  cis-1,2-dihydrobenzene-1,2-diol dehydrogenase
     X970_10605
    1.3.1.119  chlorobenzene dihydrodiol dehydrogenase
     X970_10605
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3Beta_HSD Epimerase
Other DBs
NCBI-ProteinID: AHC87840
UniProt: V9V1Y3
LinkDB
Position
2277685..2278512
AA seq 275 aa
MRLEGEVALVTGGGAGLGRAIVDRYVAEGARVAVLDKSAAGLEALRKLHGDAIVGVEGDV
RSLDSHREAVARCVEAFGKLDCLVGNAGVWDYLTQLVDIPDDLISEAFEEMFEVNVKGYI
LAAKAALPALYQSKGSAIFTVSNAGFYPGGGGVLYTAGKHAVIGLIKQLAHEWGPRIRVN
GIAPGGILGSDLRGLKSLDLQDKSISTFPLDDMLKSVLPTGRAATAEEYAGAYVFFATRG
DTVPLTGSVLNFDGGMGVRGLFEASLGAQLDKHFG
NT seq 828 nt   +upstreamnt  +downstreamnt
gtgagacttgaaggcgaagtggccttggtgacaggcggtggcgcaggcctgggcagagcg
atcgtggatcgttatgtcgcggaaggtgcgcgtgtcgcggtgctggataaatccgcggca
ggcctggaagcgctcaggaaactccatggcgatgcaatcgtgggcgtggagggggatgtt
cgctcgctcgacagccatcgtgaggctgtggcccgctgcgtcgaagcgttcggcaagctg
gactgcctggttggcaatgctggcgtttgggactacctgacccaactggtggatattccc
gacgacctcatatcggaggcattcgaggaaatgttcgaggtcaatgtcaagggctacatc
ctggcggcaaaggctgcgctacctgcgctttatcagagcaaaggcagcgcgatattcact
gtgtcgaatgccggtttctacccgggcggtggcggtgttctgtatacagctggcaaacat
gccgtgattggattgatcaagcagctcgcgcacgaatgggggccgcgtatccgcgtcaac
ggcatcgcccccggtggcattttggggagcgatctgcgcgggctgaagagccttgattta
caagacaagagcatttcgacctttccattggacgacatgctgaaatccgttcttccgacc
gggcgggccgccactgccgaggaatacgccggcgcctatgtcttcttcgcgacgcgcggc
gacacggttccgctcaccggtagcgtgttgaacttcgatggcggcatgggcgtgcgtggc
ttgttcgaagccagcctaggcgcacagctcgacaagcacttcggttga

DBGET integrated database retrieval system