KEGG   Paenibacillus mucilaginosus 3016: PM3016_4912
Entry
PM3016_4912       CDS       T01757                                 
Name
(GenBank) ABC transporter
  KO
K19349  pleuromutilin/lincosamide/streptogramin A transport system ATP-binding/permease protein
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PM3016_4912
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmq02000]
    PM3016_4912
   01504 Antimicrobial resistance genes [BR:pmq01504]
    PM3016_4912
Transporters [BR:pmq02000]
 ABC transporters, eukaryotic type
  Other subfamilies
   Macrolide exporter
    PM3016_4912
Antimicrobial resistance genes [BR:pmq01504]
 Gene variants
  Macrolide resistance genes
   Transporters
    PM3016_4912
SSDB
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 AAA_22 AAA_16 AAA_23 NACHT AAA_29 AAA MMR_HSR1 AAA_15 NB-ARC AAA_28 ORC-CDC6-like cobW DO-GTPase2 AAA_30 MobB ATPase_2 AAA_33 AAA_18 AAA_13 DUF3584 Zeta_toxin
Other DBs
NCBI-ProteinID: AFC31644
UniProt: H6NLS9
LinkDB
Position
complement(5897575..5899173)
AA seq 532 aa
MSRIEVNGLQHGVGHRPLLRADRLRIEERERIGIVGRNGAGKTTLLRILAGEIEPDEGHV
TRRGTLGVIPQFKEDGQGSGGEITIRVVEAVMAEDPDLLFADEPTTHLDEAHTERLEERL
RGVRGALVVISHDRVFLDRVCTQIWEVDGGEVRVYPGDYSAYERQKQLERRQHREKYEAY
VEKRSALERAIRLKDQKAAGAMKPPSRLGSSEARMGKDYRGSTQAGIHQAKKALETRLSK
LEKVDKPVEPPEVKLSVPMPPLAKNRVLLEVQDLEASAGERGLWSRVSFRLRFGEKAALL
GPNGCGKTTLLRRILDGGAGVRLAPGVKPGYFSQTLELLDLECSVLDNVRETSVHGDGLA
RLVLARLLLRGDDVFKRTGDLSGGERVKTALAKLVLSEAHLLVLDEPTNYLDTPSLEALE
GLLAGYPGTVLYVSHDRRFVERTAGRILEIRDGRLHSYDGGYGAYREQRDRGAAPQPAEN
DAAGELMQVELRLAEVLGRLSLPGTPDVEKLDAEFQELVKRRRALREAVKPI
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgagccgaatcgaagtgaatggactgcagcatggtgtcgggcaccgtcccttgctgcgg
gcggaccggttgagaatagaggagcgggagcggatcggtatcgtcggacgcaacggggcg
ggcaaaacgacgctccttcgcattctggccggtgagatcgagccggacgaggggcatgtg
acccgcagagggacgcttggagtgatcccccagttcaaagaagatgggcagggcagcgga
ggagagatcacgatccgcgtagtcgaagcggtgatggccgaagatccggatctgctcttc
gccgacgagccgaccacccacctggacgaggcgcataccgagcgtctcgaagaacggctg
cgcggggttcggggagccctggtcgtgatctcgcacgaccgggtgttcctggaccgggta
tgcacgcagatctgggaggtggacggaggcgaggtgcgggtctaccccggagactacagc
gcatacgagcggcagaagcagcttgaacgccggcagcaccgggagaaatatgaggcgtac
gtagagaagcgcagcgccctggagcgggcgatccggctgaaggatcagaaggcggccggc
gcaatgaagcctccgtcccggctcggaagctccgaggcccggatgggcaaagactacagg
ggctcgacgcaggccggcattcatcaagcgaagaaggcgcttgagacccgcctctcgaag
ctggagaaggtcgataagccggtcgagccgcccgaggtgaagctgtcggtgcctatgccg
ccgctagccaagaaccgggttctgctcgaagtgcaggacctggaggcttccgccggggag
cgggggctgtggagccgggtttccttccggctgcgcttcggggagaaggcggcgctgctc
ggcccgaacggctgcggcaaaacgaccctgctccggcgcattctggacgggggagcgggg
gtacggctcgcaccgggcgtgaagccggggtacttcagccagacgctggagctgcttgac
ctggagtgcagcgtgctggacaatgtaagggagacgtcggtccacggggacgggctcgcc
cgcctcgtgctggcccggctgctgctccggggggacgatgttttcaagcggaccggggac
ctgagcggcggcgagcgggtgaaaacggcgctggcgaagctggtgctgagcgaggcccat
ctgctcgtgcttgacgagccgacgaattacctcgatacgccttccctcgaagcgctggag
ggacttctggccggttatccgggaacggtgctctacgtctcccacgaccgccggtttgtc
gagcggaccgcgggccgcatcctggagatccgggacggccggctgcattcgtatgacggc
ggttatggggcgtaccgggagcagcgggaccgcggggccgctccgcagcctgcggagaat
gacgcggcaggcgagctgatgcaggtcgagctccgcctggcggaggtgctcggacgccta
agcctgccgggcaccccggatgtggagaagctcgacgcggagttccaggagctcgtgaag
cggcgcagggcgctgcgggaagcggtgaagccgatctga

DBGET integrated database retrieval system