Paenibacillus mucilaginosus 3016: PM3016_4912
Help
Entry
PM3016_4912 CDS
T01757
Name
(GenBank) ABC transporter
KO
K19349
pleuromutilin/lincosamide/streptogramin A transport system ATP-binding/permease protein
Organism
pmq
Paenibacillus mucilaginosus 3016
Pathway
pmq02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
pmq00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
PM3016_4912
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
pmq02000
]
PM3016_4912
01504 Antimicrobial resistance genes [BR:
pmq01504
]
PM3016_4912
Transporters [BR:
pmq02000
]
ABC transporters, eukaryotic type
Other subfamilies
Macrolide exporter
PM3016_4912
Antimicrobial resistance genes [BR:
pmq01504
]
Gene variants
Macrolide resistance genes
Transporters
PM3016_4912
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
ABC_tran_Xtn
AAA_21
AAA_22
AAA_16
AAA_23
NACHT
AAA_29
AAA
MMR_HSR1
AAA_15
NB-ARC
AAA_28
ORC-CDC6-like
cobW
DO-GTPase2
AAA_30
MobB
ATPase_2
AAA_33
AAA_18
AAA_13
DUF3584
Zeta_toxin
Motif
Other DBs
NCBI-ProteinID:
AFC31644
UniProt:
H6NLS9
LinkDB
All DBs
Position
complement(5897575..5899173)
Genome browser
AA seq
532 aa
AA seq
DB search
MSRIEVNGLQHGVGHRPLLRADRLRIEERERIGIVGRNGAGKTTLLRILAGEIEPDEGHV
TRRGTLGVIPQFKEDGQGSGGEITIRVVEAVMAEDPDLLFADEPTTHLDEAHTERLEERL
RGVRGALVVISHDRVFLDRVCTQIWEVDGGEVRVYPGDYSAYERQKQLERRQHREKYEAY
VEKRSALERAIRLKDQKAAGAMKPPSRLGSSEARMGKDYRGSTQAGIHQAKKALETRLSK
LEKVDKPVEPPEVKLSVPMPPLAKNRVLLEVQDLEASAGERGLWSRVSFRLRFGEKAALL
GPNGCGKTTLLRRILDGGAGVRLAPGVKPGYFSQTLELLDLECSVLDNVRETSVHGDGLA
RLVLARLLLRGDDVFKRTGDLSGGERVKTALAKLVLSEAHLLVLDEPTNYLDTPSLEALE
GLLAGYPGTVLYVSHDRRFVERTAGRILEIRDGRLHSYDGGYGAYREQRDRGAAPQPAEN
DAAGELMQVELRLAEVLGRLSLPGTPDVEKLDAEFQELVKRRRALREAVKPI
NT seq
1599 nt
NT seq
+upstream
nt +downstream
nt
atgagccgaatcgaagtgaatggactgcagcatggtgtcgggcaccgtcccttgctgcgg
gcggaccggttgagaatagaggagcgggagcggatcggtatcgtcggacgcaacggggcg
ggcaaaacgacgctccttcgcattctggccggtgagatcgagccggacgaggggcatgtg
acccgcagagggacgcttggagtgatcccccagttcaaagaagatgggcagggcagcgga
ggagagatcacgatccgcgtagtcgaagcggtgatggccgaagatccggatctgctcttc
gccgacgagccgaccacccacctggacgaggcgcataccgagcgtctcgaagaacggctg
cgcggggttcggggagccctggtcgtgatctcgcacgaccgggtgttcctggaccgggta
tgcacgcagatctgggaggtggacggaggcgaggtgcgggtctaccccggagactacagc
gcatacgagcggcagaagcagcttgaacgccggcagcaccgggagaaatatgaggcgtac
gtagagaagcgcagcgccctggagcgggcgatccggctgaaggatcagaaggcggccggc
gcaatgaagcctccgtcccggctcggaagctccgaggcccggatgggcaaagactacagg
ggctcgacgcaggccggcattcatcaagcgaagaaggcgcttgagacccgcctctcgaag
ctggagaaggtcgataagccggtcgagccgcccgaggtgaagctgtcggtgcctatgccg
ccgctagccaagaaccgggttctgctcgaagtgcaggacctggaggcttccgccggggag
cgggggctgtggagccgggtttccttccggctgcgcttcggggagaaggcggcgctgctc
ggcccgaacggctgcggcaaaacgaccctgctccggcgcattctggacgggggagcgggg
gtacggctcgcaccgggcgtgaagccggggtacttcagccagacgctggagctgcttgac
ctggagtgcagcgtgctggacaatgtaagggagacgtcggtccacggggacgggctcgcc
cgcctcgtgctggcccggctgctgctccggggggacgatgttttcaagcggaccggggac
ctgagcggcggcgagcgggtgaaaacggcgctggcgaagctggtgctgagcgaggcccat
ctgctcgtgcttgacgagccgacgaattacctcgatacgccttccctcgaagcgctggag
ggacttctggccggttatccgggaacggtgctctacgtctcccacgaccgccggtttgtc
gagcggaccgcgggccgcatcctggagatccgggacggccggctgcattcgtatgacggc
ggttatggggcgtaccgggagcagcgggaccgcggggccgctccgcagcctgcggagaat
gacgcggcaggcgagctgatgcaggtcgagctccgcctggcggaggtgctcggacgccta
agcctgccgggcaccccggatgtggagaagctcgacgcggagttccaggagctcgtgaag
cggcgcagggcgctgcgggaagcggtgaagccgatctga
DBGET
integrated database retrieval system