Petromyzon marinus (sea lamprey): 116950081 Help Entry 116950081         CDS       T09614                                  Symbol RAN Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism pmrn  Petromyzon marinus (sea lamprey) Pathway pmrn03008   Ribosome biogenesis in eukaryotes pmrn03013   Nucleocytoplasmic transport pmrn03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:pmrn00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     116950081 (RAN)    03008 Ribosome biogenesis in eukaryotes     116950081 (RAN)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     116950081 (RAN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pmrn03019]     116950081 (RAN)    03009 Ribosome biogenesis [BR:pmrn03009]     116950081 (RAN)    03016 Transfer RNA biogenesis [BR:pmrn03016]     116950081 (RAN)    03036 Chromosome and associated proteins [BR:pmrn03036]     116950081 (RAN)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmrn04147]     116950081 (RAN)    04031 GTP-binding proteins [BR:pmrn04031]     116950081 (RAN) Messenger RNA biogenesis [BR:pmrn03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      116950081 (RAN) Ribosome biogenesis [BR:pmrn03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     116950081 (RAN)   Pre-60S particles     116950081 (RAN) Transfer RNA biogenesis [BR:pmrn03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     116950081 (RAN) Chromosome and associated proteins [BR:pmrn03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      116950081 (RAN)    Spindle formation proteins     116950081 (RAN) Exosome [BR:pmrn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116950081 (RAN) GTP-binding proteins [BR:pmrn04031]  Small (monomeric) G-proteins   Ran Family    Ran     116950081 (RAN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RNA_helicase Gtr1_RagA G-alpha AAA_24 Pox_A32 ArgoMid Septin AAA_7 AAA_16 TsaE DUF5906 AAA_22 Motif Other DBs NCBI-GeneID:  116950081 NCBI-ProteinID:  XP_032823405 UniProt:  A0AAJ7TSI4 LinkDB All DBs Position 38:8652034..8656899 Genome browser AA seq 216 aa AA seqDB search MAAHEEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIK FNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLC GNKVDIKDRKVKAKAIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMP ALAPPEVQMDPQLVAQYEEDLKVAQATALPDEEDDL NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggctgcacacgaggaaccccaagtacagttcaagttggtgctggtaggagatggaggc accggcaagaccacatttgtgaaacgccacctcacgggagagtttgagaagaagtatgtt gctacactgggcgtggaggtgcatcccctggtgtttcataccaaccgtggcgctatcaaa ttcaacgtgtgggacacagccggccaagagaagtttggtggcctgcgtgacggttactac atccagggtcagtgcgccatcatcatgttcgacgtgacgtcacgtgtgacgtacaagaac gtgccgaactggcaccgtgacttggtgcgggtttgtgagaatatccccatcgtcctgtgc ggcaacaaggtggacatcaaggaccgtaaagtaaaggccaaggccattgtcttccaccgc aagaaaaacctacagtattatgacatctcggccaagagcaactacaactttgagaagccg ttcctgtggctggcacgcaagcttatcggagaccccaacctggagtttgtggccatgcct gcgctggccccaccggaggtgcagatggacccccagctggtggcacagtacgaggaagac ctcaaggttgcccaggcgaccgctttgcccgacgaagaagatgacctgtga

DBGET integrated database retrieval system