Petromyzon marinus (sea lamprey): 116951478 Help Entry 116951478         CDS       T09614                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pmrn  Petromyzon marinus (sea lamprey) Pathway pmrn03420   Nucleotide excision repair pmrn04110   Cell cycle pmrn04114   Oocyte meiosis pmrn04120   Ubiquitin mediated proteolysis pmrn04141   Protein processing in endoplasmic reticulum pmrn04310   Wnt signaling pathway pmrn04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:pmrn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     116951478 (RBX1)    04120 Ubiquitin mediated proteolysis     116951478 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     116951478 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     116951478 (RBX1)    04350 TGF-beta signaling pathway     116951478 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     116951478 (RBX1)    04114 Oocyte meiosis     116951478 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pmrn04121]     116951478 (RBX1)    03400 DNA repair and recombination proteins [BR:pmrn03400]     116951478 (RBX1) Enzymes [BR:pmrn01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      116951478 (RBX1) Ubiquitin system [BR:pmrn04121]  Ubiquitin ligases (E3)   UBL E3 ligases    116951478 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      116951478 (RBX1)    Cul2 complex      116951478 (RBX1)    Cul3 complex      116951478 (RBX1)    Cul4 complex      116951478 (RBX1)    Cul7 complex      116951478 (RBX1)    Cul8 complex      116951478 (RBX1)    Cul9 complex      116951478 (RBX1) DNA repair and recombination proteins [BR:pmrn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       116951478 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       116951478 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  116951478 NCBI-ProteinID:  XP_032825996 UniProt:  A0AAJ7X996 LinkDB All DBs Position 43:complement(5603666..5608398) Genome browser AA seq 110 aa AA seqDB search MASAMEVDTPCASSTAGGGGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQA NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggcgtcggcaatggaggtggacacgccgtgcgcttcgtccaccgctggcggcggcggc aagaagcgcttcgaggtcaagaagtggaatgctgtggccctgtgggcctgggatattgtc gtggataactgtgccatctgccgcaaccacataatggacctctgcattgagtgtcaggcg aaccaagcatcagccacctcggaggaatgtacagtggcttggggcgtctgcaatcatgca ttccacttccactgcatctcacgctggcttaaaaccaggcaggtctgtcccctcgacaat cgtgagtgggaattccagaagtatggacattaa

DBGET integrated database retrieval system