Petromyzon marinus (sea lamprey): 116951880 Help Entry 116951880         CDS       T09614                                  Symbol POLE4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism pmrn  Petromyzon marinus (sea lamprey) Pathway pmrn03030   DNA replication pmrn03410   Base excision repair pmrn03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pmrn00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     116951880 (POLE4)    03410 Base excision repair     116951880 (POLE4)    03420 Nucleotide excision repair     116951880 (POLE4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pmrn03032]     116951880 (POLE4)    03400 DNA repair and recombination proteins [BR:pmrn03400]     116951880 (POLE4) Enzymes [BR:pmrn01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      116951880 (POLE4) DNA replication proteins [BR:pmrn03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     116951880 (POLE4) DNA repair and recombination proteins [BR:pmrn03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       116951880 (POLE4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C Motif Other DBs NCBI-GeneID:  116951880 NCBI-ProteinID:  XP_032826578 UniProt:  A0AAJ7U1H5 LinkDB All DBs Position 44:complement(5056393..5062967) Genome browser AA seq 95 aa AA seqDB search MAEAVVVAGEEERPRLSRLPLSRVKSIMKADPDVALAAHEAVFLIAKATELFIEAIAKDA YGFALQGKRKTLQRKDLDNAVDAVDEFAFLEGALD NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcggaggcggtcgttgtcgccggcgaggaggagaggcccaggctgagtcgcctcccg ctcagccgcgtcaagagcatcatgaaggccgaccccgacgtggcgctcgccgcccacgag gctgtcttcctcatcgccaaggccacggagttgttcatcgaggccatagctaaggacgcc tacggatttgcgctgcagggaaagcggaaaaccctgcagaggaaggacctggacaacgcg gtggacgcagtggacgagtttgcgtttctagaaggagcactggactag

DBGET integrated database retrieval system