Pasteurella multocida ATCC 43137: DR93_41 Help Entry DR93_41           CDS       T03322                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism pmul  Pasteurella multocida ATCC 43137 Pathway pmul00670   One carbon pool by folate pmul00790   Folate biosynthesis pmul01100   Metabolic pathways pmul01240   Biosynthesis of cofactors pmul04981   Folate transport and metabolism Module pmul_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pmul00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     DR93_41 (folA)    00670 One carbon pool by folate     DR93_41 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     DR93_41 (folA) Enzymes [BR:pmul01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      DR93_41 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AIN49490 LinkDB All DBs Position 37210..37704 Genome browser AA seq 164 aa AA seqDB search MIFSLIVAMTKNHVIGKDNQMPWHLPADLAWFRQNTTGKPVIMGRKTFESIGRPLPKRTN LVLSRQPYLHEGVIWQNSLESAVDFVKDSPEILLIGGGELFKQYLHKADKLYLTEIQTEL EGDTFFPEIVWQDWQIEYEAWRQADEKNPYDCRFLILSRNTKNE NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgatctttagccttatcgtcgctatgacgaaaaaccatgtcattggtaaagacaatcaa atgccttggcatctgcctgccgatttagcgtggtttcgccagaataccacgggtaaaccg gtgattatgggacgaaaaacctttgaaagcattgggcgtccattaccaaaacgcactaat ttagtgctttctcgtcagccatatctacatgagggcgtgatttggcaaaacagccttgaa agtgcggtggattttgtcaaagattcacctgaaatcctgttgattggcgggggcgaatta tttaagcaatatttacataaagccgacaagctctatctcactgaaatccaaacagaatta gaaggcgataccttctttcctgaaattgtatggcaagactggcaaattgaatatgaagca tggcgccaagccgatgaaaaaaatccttatgactgtcgctttttaattttatcgcgtaac actaaaaatgaatga

DBGET integrated database retrieval system