Prunus mume (Japanese apricot): 103331948 Help Entry 103331948         CDS       T03196                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pmum  Prunus mume (Japanese apricot) Pathway pmum03420   Nucleotide excision repair pmum04120   Ubiquitin mediated proteolysis pmum04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pmum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103331948    04120 Ubiquitin mediated proteolysis     103331948   09124 Replication and repair    03420 Nucleotide excision repair     103331948  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pmum04121]     103331948    03400 DNA repair and recombination proteins [BR:pmum03400]     103331948 Enzymes [BR:pmum01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103331948 Ubiquitin system [BR:pmum04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103331948   Multi subunit type E3    SCF complex     Ring finger protein      103331948    Cul2 complex      103331948    Cul3 complex      103331948    Cul4 complex      103331948    Cul7 complex      103331948    Cul8 complex      103331948    Cul9 complex      103331948 DNA repair and recombination proteins [BR:pmum03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103331948     TCR (transcription coupled repair) factors      Cul4-CSA complex       103331948 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  103331948 NCBI-ProteinID:  XP_008232845 UniProt:  A0ABM0P100 LinkDB All DBs Position LG5:16168710..16171610 Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMVPVGEASSSAGSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcaacattggattcagacgtgcctatggttccggtaggtgaggcttcaagcagtgca ggttcatcgaccaagaagcccaagcgatttgagatcaagaagtggaatgctgtagctctc tgggcctgggatattgttgttgataactgtgccatttgcaggaaccatatcatggatctc tgcattgagtgccaagcaaaccaggcaagcgccacaagcgaggagtgtacagttgcttgg ggggtttgcaaccatgcattccacttccactgcataagccgatggctcaagacccgccaa gtgtgtccattagataatagcgagtgggagtttcagaagtatggtcattag

DBGET integrated database retrieval system