Prunus mume (Japanese apricot): 103331952 Help Entry 103331952         CDS       T03196                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pmum  Prunus mume (Japanese apricot) Pathway pmum03420   Nucleotide excision repair pmum04120   Ubiquitin mediated proteolysis pmum04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pmum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103331952    04120 Ubiquitin mediated proteolysis     103331952   09124 Replication and repair    03420 Nucleotide excision repair     103331952  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pmum04121]     103331952    03400 DNA repair and recombination proteins [BR:pmum03400]     103331952 Enzymes [BR:pmum01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103331952 Ubiquitin system [BR:pmum04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103331952   Multi subunit type E3    SCF complex     Ring finger protein      103331952    Cul2 complex      103331952    Cul3 complex      103331952    Cul4 complex      103331952    Cul7 complex      103331952    Cul8 complex      103331952    Cul9 complex      103331952 DNA repair and recombination proteins [BR:pmum03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103331952     TCR (transcription coupled repair) factors      Cul4-CSA complex       103331952 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  103331952 NCBI-ProteinID:  XP_008232851 UniProt:  A0ABM0P106 LinkDB All DBs Position LG5:16199592..16202015 Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMVPVGEASSSAGPSSTKRPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggccacattggactctgatgtgccgatggtaccggtaggcgaggcttcgagcagcgct ggtccttcttcgaccaagaggcccaagcggttcgagatcaagaagtggaatgctgtagct ctctgggcgtgggatattgtggttgataactgtgccatttgcaggaaccatatcatggat ctctgcatcgagtgccaagcgaaccaggcaagtgccacaagtgaggagtgtacggttgct tggggggtctgtaaccatgcattccacttccattgcataagccgatggctgaaaacccgc caagtgtgtccgttggataacagcgagtgggagtttcagaagtacggtcactag

DBGET integrated database retrieval system