Polaromonas naphthalenivorans: Pnap_3072
Help
Entry
Pnap_3072 CDS
T00459
Name
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
pna
Polaromonas naphthalenivorans
Pathway
pna00061
Fatty acid biosynthesis
pna00780
Biotin metabolism
pna01100
Metabolic pathways
pna01110
Biosynthesis of secondary metabolites
pna01212
Fatty acid metabolism
pna01240
Biosynthesis of cofactors
Module
pna_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
pna00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
Pnap_3072
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
Pnap_3072
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
Pnap_3072
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
pna01004
]
Pnap_3072
Enzymes [BR:
pna01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
Pnap_3072
Lipid biosynthesis proteins [BR:
pna01004
]
Fatty acid synthase
Component type
Pnap_3072
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
SDR
Epimerase
Motif
Other DBs
NCBI-ProteinID:
ABM38371
UniProt:
A1VRU3
LinkDB
All DBs
Position
complement(3244600..3245346)
Genome browser
AA seq
248 aa
AA seq
DB search
MSEIRFEGQVALVTGASRGIGAAIALELAKKGLRVTGTATTDEGAAKISRTLAAYPGCQG
QTLDVNDAAAAEALVNRIVTECGGLQVLVNNAGITRDMLAMRLKDDDWDAVLDTNLKAVF
RMSRAVMRCMMKQRYGRIISITSVVGASGNAGQANYAAAKAGVAGMTRALARELGSRSIT
VNCVAPGFIETDMTARLPEEQQKALLGQIPLGHLGKPQDIAHAVAFLASPLASYITGQEI
HVNGGMYM
NT seq
747 nt
NT seq
+upstream
nt +downstream
nt
atgagcgaaatcaggtttgaaggacaggtggcgctggtgaccggcgcctcgcgcggcatc
ggcgcagccattgcgctggaactcgccaaaaaaggcttgagggtgaccggcacggccacc
accgatgagggcgccgcgaaaatcagccgcaccctggccgcctatccaggatgccagggc
cagacgctcgatgtgaacgacgcagccgctgccgaagcgctggtcaaccgcatcgtgacc
gaatgcggcggcctgcaggtactcgtcaacaatgccggcatcactcgcgacatgctggcg
atgcgtcttaaagacgacgattgggacgcggtgctcgacaccaacctgaaggccgtgttt
cgcatgagccgggccgtgatgcgctgcatgatgaagcagcgctacggccgtatcatcagc
atcacctcggtggtgggcgcttccggcaatgcggggcaggccaattacgccgccgccaag
gccggcgttgccggcatgacgcgtgcgctggcgcgagaacttggctcgcgcagcatcacg
gtcaactgcgtggcgcccggctttattgaaaccgacatgacggcgcgcttgcccgaagaa
cagcaaaaggcgctgctcggacagataccgctgggccatctgggcaaaccgcaggacatt
gcgcatgcggtggcatttctggccagtccgctggcgtcctacatcacgggccaggaaatt
catgtcaatggcggcatgtacatgtaa
DBGET
integrated database retrieval system