Pieris napi (green-veined white): 125049545 Help Entry 125049545         CDS       T08706                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism pnap  Pieris napi (green-veined white) Pathway pnap00510   N-Glycan biosynthesis pnap00513   Various types of N-glycan biosynthesis pnap04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pnap00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     125049545    00513 Various types of N-glycan biosynthesis     125049545  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125049545 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 CAAD Motif Other DBs NCBI-GeneID:  125049545 NCBI-ProteinID:  XP_047504863 LinkDB All DBs Position 5:368843..369403 Genome browser AA seq 81 aa AA seqDB search MSLEIESMVRHVSPINPAVFPHLTLLLLSIGIFFTAWFFVYEVTSTKSSRDLFKELLLSL VASLFSGFGILFLLLWVGIYV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtctggaaatagaatcaatggttcgtcatgtatctccaatcaaccctgcagtgttt ccgcatcttactctgcttctcttaagcattggaatattctttacagcgtggttcttcgtg tatgaagttacaagcacaaagagttccagagatttatttaaggagctcctgttatcattg gtagcatccttgttttcagggtttggtatcttgtttttattactttgggtaggcatatat gtctag

DBGET integrated database retrieval system