KEGG   Pseudomonas nunensis: NK667_17860
Entry
NK667_17860       CDS       T08997                                 
Symbol
ligA
Name
(GenBank) NAD-dependent DNA ligase LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
pnb  Pseudomonas nunensis
Pathway
pnb03030  DNA replication
pnb03410  Base excision repair
pnb03420  Nucleotide excision repair
pnb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pnb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    NK667_17860 (ligA)
   03410 Base excision repair
    NK667_17860 (ligA)
   03420 Nucleotide excision repair
    NK667_17860 (ligA)
   03430 Mismatch repair
    NK667_17860 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pnb03032]
    NK667_17860 (ligA)
   03400 DNA repair and recombination proteins [BR:pnb03400]
    NK667_17860 (ligA)
Enzymes [BR:pnb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     NK667_17860 (ligA)
DNA replication proteins [BR:pnb03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     NK667_17860 (ligA)
DNA repair and recombination proteins [BR:pnb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     NK667_17860 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     NK667_17860 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     NK667_17860 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NK667_17860 (ligA)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 BRCT Nlig-Ia DNA_ligase_ZBD DUF4796_N PTCB-BRCT RUBY_RBDX
Other DBs
NCBI-ProteinID: UTO12041
UniProt: A0ABY5EA70
LinkDB
Position
complement(4112895..4115252)
AA seq 785 aa
MTAAKTRILELRAELDQHNYRYHVMDEPSIPDAEYDRLFHELKALEAANPELITSDSPTQ
RVGSAALSAFTQVRHEVPMLSLGNAFEETDMREFDRRVTEGLDLPAGDLFGGGAAVEYSC
EPKLDGLAVSLLYQDGVLVRGATRGDGTTGEDISVNVRTVRNIPLKLHGNGWPATLEVRG
EVFMSKAGFERLNATQLEVGGKTFANPRNAAAGSLRQLDSKITANRPLEFCCYGIGQISA
DIADTHIGNLKQLQVWGMPISHELKLAHGIGECLDYYRDIGERRNALGYEIDGVVFKVNS
IASQRELGFRAREPRWAIAHKFPAMEELTELLDVEFQVGRTGAVTPVARLKPVKVAGVTV
ANATLHNMDEVARLGLMIGDTVIIRRAGDVIPQVVQVILERRPENARAVQIPEQCPVCGS
HVERTQLVKRSKGRETVSEGAVYRCVGRLACGAQLKQAIIHFVSRRAMDIEGLGDKSVEQ
LVDEGLVSSPADLYALKFEDIVDLEGFAELSSKKLLGAIEDSKRPSLARFIYALGIPDVG
EETAKVLARSLGSLERVQQALPQVLTYLPDVGLEVAYEIHSFFEDAHNQQVIEELLKHGL
QIQDQGELGAEFSASTTLGGFLDKLHIPSVGPGGAQKLADKFGSLKGVFDADWLDMRQAL
PEKQANSVRDFFAVAENRQIAEAAEKQLRDFGMHWQSEKKVVEGLPLAGQTWVLTGSLEL
MSRDVAKDKLEGLGAKVAGSVSAKTHCVVAGPGAGSKLAKANELGLKVLDEEAFVDFLKK
HGIAI
NT seq 2358 nt   +upstreamnt  +downstreamnt
atgaccgccgccaaaacccgcattctagagctgcgcgctgagctggatcagcacaactat
cgctatcacgtgatggacgagccgagcattccggacgccgagtacgaccggttgttccat
gagctcaaggccctcgaagcggccaatcccgaactgatcaccagcgactcgccgacccag
cgcgtcggcagcgcagcgctgtcggcgttcactcaggtgcgtcatgaagtgccgatgctc
agcctcggcaacgccttcgaagaaaccgacatgcgcgagttcgatcggcgtgtcaccgaa
ggtctggacctgccggccggcgacttgttcggcggcggcgcggcggtggaatacagctgc
gaaccgaaactcgatggcctggcggtcagcctgttgtatcaggacggtgtgctggtacgc
ggcgccacacgcggcgacggcaccaccggcgaagacatcagcgtcaacgtgcgcaccgtg
cgcaacatcccgctcaaactgcacggcaacggctggccggcgaccctggaagtgcgcggc
gaagtgttcatgtccaaggccggtttcgaacggctcaacgccacgcaactggaagtcggt
ggcaagactttcgccaacccgcgaaacgccgcggccggcagcttgcgtcaactggattcg
aagatcaccgctaaccgtccgctggaattctgctgctacggcatcggccagatttcggcg
gacattgccgacactcacattggcaatctcaagcagttgcaggtgtggggcatgccgatc
agtcatgagctgaaactggcgcacggcatcggcgaatgcctggattactaccgcgacatc
ggcgagcgccgcaatgcgctgggctatgaaatcgatggcgtggtgttcaaggtcaacagc
attgcctcgcagcgtgaattggggttccgcgcccgcgagccgcgttgggcgatcgcccac
aaattcccggcgatggaagaactcaccgagttgctcgatgtggaattccaggttggccgc
accggcgccgtcacgccggtcgcacgcttgaaaccagtcaaggttgccggcgtgaccgtg
gctaacgcgacgttgcacaacatggatgaagtggcgcgcctgggcttgatgatcggcgac
accgtgatcatccgtcgcgcaggcgatgtgattccgcaagtggtgcaagtgatccttgag
cgtcgtccggaaaatgcccgggcggtgcagattcccgaacagtgcccggtgtgcggctcg
cacgtggagcgcacgcaactggtcaagcgcagcaaaggtcgcgagaccgtcagcgaaggc
gcggtgtatcgttgcgtcgggcgtctggcctgcggcgcgcaactgaagcaggcgatcatc
catttcgtctcccgtcgtgccatggacatcgaaggcctgggcgacaagagcgtcgagcaa
ttggtcgatgaaggcctggtgagttcgccggctgatctgtatgcgctgaagttcgaagac
attgtcgacctggaaggctttgccgagctgtcgagcaaaaaactcctcggcgctatcgaa
gacagcaagcgaccgagcctggcgcgtttcatctacgccctcgggatccccgatgtcggc
gaagagacggccaaggtgttggcgcgctccctgggctcgctggagcgggttcaacaggcg
ttgccgcaagtgttgacgtacttgccggacgtcggcctggaagtggcgtatgagattcac
agcttcttcgaagatgcgcacaaccagcaagtgatcgaggagctgctcaaacacggtttg
cagattcaggatcagggcgagttaggtgccgagttttctgcgagcactaccctcggcggg
ttcctcgacaagctgcacattccatcggtggggccgggcggggcgcagaaactggcggac
aagtttggttcgctcaaaggtgtgtttgacgctgactggctggatatgcgccaggcgttg
ccggagaagcaggcgaattcggttcgggatttttttgcggtggcagagaatcgccagatt
gctgaagcagccgagaagcaattgcgtgatttcggcatgcactggcagagcgagaagaaa
gtcgtcgaaggcctgccgctggctgggcagacctgggtgctgaccggttcgctggaattg
atgagccgcgatgtggccaaggacaaactcgaaggccttggcgccaaagtggcgggctcg
gtgtcggccaagacgcattgcgtggttgcggggccgggcgccggatcgaagttggccaag
gccaatgagcttgggctgaaggtgctggatgaggaagcgtttgtcgacttcctgaaaaaa
cacggcattgcgatctga

DBGET integrated database retrieval system