Pandoraea norimbergensis: AT302_05780 Help Entry AT302_05780       CDS       T04226                                  Name (GenBank) acyl carrier protein   KO K14188   D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13] Organism pnr  Pandoraea norimbergensis Pathway pnr00470   D-Amino acid metabolism pnr00552   Teichoic acid biosynthesis pnr01100   Metabolic pathways pnr01503   Cationic antimicrobial peptide (CAMP) resistance pnr02020   Two-component system Brite KEGG Orthology (KO) [BR:pnr00001]  09100 Metabolism   09106 Metabolism of other amino acids    00470 D-Amino acid metabolism     AT302_05780   09107 Glycan biosynthesis and metabolism    00552 Teichoic acid biosynthesis     AT302_05780  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AT302_05780  09160 Human Diseases   09175 Drug resistance: antimicrobial    01503 Cationic antimicrobial peptide (CAMP) resistance     AT302_05780  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    01504 Antimicrobial resistance genes [BR:pnr01504]     AT302_05780 Enzymes [BR:pnr01000]  6. Ligases   6.1  Forming carbon-oxygen bonds    6.1.1  Ligases forming aminoacyl-tRNA and related compounds     6.1.1.13  D-alanine---poly(phosphoribitol) ligase      AT302_05780 Antimicrobial resistance genes [BR:pnr01504]  Gene sets   CAMP resistance modules    Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]     AT302_05780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7215 Motif Other DBs NCBI-ProteinID:  ALS59340 UniProt:  A0ABM5WGF2 LinkDB All DBs Position complement(5658687..5658926) Genome browser AA seq 79 aa AA seqDB search MNINDIESKLADIVGNIVLTQVEPDTLLIDSGLVDSLSAVDVVLAVEREFGVKVPPSEID VYLQSVQTLAAFIAEQKGA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaacatcaatgacatcgaaagcaaactcgccgacatcgtcggcaacatcgtgctcacg caggtcgaacccgacacgctgctgatcgattcggggctggtcgattcgctctcggccgtg gacgtggtgctggcggtcgagcgcgaattcggcgtgaaagtgccgccgtcggagatcgac gtgtatctgcagtcggtacagacgcttgcggcattcattgccgaacagaaaggcgcctga

DBGET integrated database retrieval system