Populus nigra (Lombardy poplar): 133693866 Help Entry 133693866         CDS       T10372                                  Name (RefSeq) sm-like protein LSM3B   KO K12622   U6 snRNA-associated Sm-like protein LSm3 Organism pnz  Populus nigra (Lombardy poplar) Pathway pnz03018   RNA degradation pnz03040   Spliceosome Brite KEGG Orthology (KO) [BR:pnz00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     133693866   09123 Folding, sorting and degradation    03018 RNA degradation     133693866  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pnz03019]     133693866    03041 Spliceosome [BR:pnz03041]     133693866 Messenger RNA biogenesis [BR:pnz03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      133693866   mRNA degradation factors    5'-3' decay     Lsm complex      133693866 Spliceosome [BR:pnz03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     133693866  Complex C   U2 snRNP components     133693866 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM TIG_SUH Glutaredoxin Motif Other DBs NCBI-GeneID:  133693866 NCBI-ProteinID:  XP_061971206 LinkDB All DBs Position 5:5038691..5040895 Genome browser AA seq 97 aa AA seqDB search MASEEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEEIVTTVE IDDETYEEIVRTTRRTVPFLFVRGDGVILVSPPLRTA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcaagcgaagaagagagtgcggtaaaagaaccattggatctcatcagacttagcctg gacgagcgtatctatgtcaagctccgctctgatcgtgagcttcgcggcaaacttcacgct tatgatcagcatttgaatatgattcttggggatgttgaagaaattgttactacagtagaa atcgatgatgaaacctatgaagagattgttcggactacaaggcgcacagtgcccttcctg tttgttagaggagatggtgtcatattggtctctcctccattgaggacagcttaa

DBGET integrated database retrieval system