Populus nigra (Lombardy poplar): 133700613 Help Entry 133700613         CDS       T10372                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pnz  Populus nigra (Lombardy poplar) Pathway pnz03420   Nucleotide excision repair pnz04120   Ubiquitin mediated proteolysis pnz04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pnz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     133700613    04120 Ubiquitin mediated proteolysis     133700613   09124 Replication and repair    03420 Nucleotide excision repair     133700613  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pnz04121]     133700613    03400 DNA repair and recombination proteins [BR:pnz03400]     133700613 Enzymes [BR:pnz01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      133700613 Ubiquitin system [BR:pnz04121]  Ubiquitin ligases (E3)   UBL E3 ligases    133700613   Multi subunit type E3    SCF complex     Ring finger protein      133700613    Cul2 complex      133700613    Cul3 complex      133700613    Cul4 complex      133700613    Cul7 complex      133700613    Cul8 complex      133700613    Cul9 complex      133700613 DNA repair and recombination proteins [BR:pnz03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       133700613     TCR (transcription coupled repair) factors      Cul4-CSA complex       133700613 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  133700613 NCBI-ProteinID:  XP_061980173 LinkDB All DBs Position 8:complement(9631294..9633858) Genome browser AA seq 110 aa AA seqDB search MDTDVTMVPAGEASSSSSRKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQA NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggacacggacgtgacgatggttccggcaggcgaggcaagctcctcttcctcaaggaaa ccgaagcgattcgaaattaagaagtggaatgctgttgctctttgggcttgggatattgtg gtggataattgcgctatttgtagaaaccatatcatggatctttgcattgagtgccaagca aatcaagctagtgctacaagcgaggagtgcactgttgcctggggtgtgtgcaaccatgcc ttccacttccactgtatcagccggtggctcaaaacccgccaagtgtgtcctctcgataat agtgagtgggagtttcagaagtatggccactaa

DBGET integrated database retrieval system