Pongo abelii (Sumatran orangutan): 100171907 Help Entry 100171907         CDS       T01416                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04010   MAPK signaling pathway pon04014   Ras signaling pathway pon04015   Rap1 signaling pathway pon04024   cAMP signaling pathway pon04062   Chemokine signaling pathway pon04510   Focal adhesion pon04520   Adherens junction pon04611   Platelet activation pon04670   Leukocyte transendothelial migration pon04720   Long-term potentiation pon04722   Neurotrophin signaling pathway pon04934   Cushing syndrome pon04972   Pancreatic secretion pon05211   Renal cell carcinoma pon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100171907 (RAP1B)    04014 Ras signaling pathway     100171907 (RAP1B)    04015 Rap1 signaling pathway     100171907 (RAP1B)    04024 cAMP signaling pathway     100171907 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     100171907 (RAP1B)    04520 Adherens junction     100171907 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100171907 (RAP1B)    04670 Leukocyte transendothelial migration     100171907 (RAP1B)    04062 Chemokine signaling pathway     100171907 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     100171907 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     100171907 (RAP1B)    04722 Neurotrophin signaling pathway     100171907 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     100171907 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100171907 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     100171907 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     100171907 (RAP1B)    04031 GTP-binding proteins [BR:pon04031]     100171907 (RAP1B) Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100171907 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    100171907 (RAP1B)   Exosomal proteins of colorectal cancer cells    100171907 (RAP1B) GTP-binding proteins [BR:pon04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     100171907 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  100171907 NCBI-ProteinID:  NP_001125027 Ensembl:  ENSPPYG00000004751 UniProt:  Q5RDM6 A0A2J8W0U2 LinkDB All DBs Position 10:66612893..66663682 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaagtctgctttgact gtacaatttgttcaaggaatttttgtagaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggagcaatttacagcaatgagggatttatacatgaaaaatggacaaggatttgcatta gtttattccatcacagcacagtccacatttaacgatttacaagacctgagagaacagatt cttcgagttaaagacactgatgatgttccaatgattcttgttggtaataagtgtgatttg gaagatgaaagagttgtagggaaggaacaaggtcaaaatctagcaagacaatggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggctcgcaagaagtcatca tgtcagctgctttaa

DBGET integrated database retrieval system