| Entry |
|
|---|
| Symbol |
GNG4
|
|---|
| Name |
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4
|
|---|
| KO |
| K04541 | guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 |
|
|---|
| Organism |
pon Pongo abelii (Sumatran orangutan)
|
|---|
| Pathway |
| pon04723 | Retrograde endocannabinoid signaling |
| pon05163 | Human cytomegalovirus infection |
| pon05167 | Kaposi sarcoma-associated herpesvirus infection |
| pon05170 | Human immunodeficiency virus 1 infection |
|
|---|
| Brite |
KEGG Orthology (KO) [BR:pon00001]
09130 Environmental Information Processing
09132 Signal transduction
04014 Ras signaling pathway
100190818 (GNG4)
04371 Apelin signaling pathway
100190818 (GNG4)
04151 PI3K-Akt signaling pathway
100190818 (GNG4)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
100190818 (GNG4)
04081 Hormone signaling
100190818 (GNG4)
09150 Organismal Systems
09151 Immune system
04062 Chemokine signaling pathway
100190818 (GNG4)
09152 Endocrine system
04926 Relaxin signaling pathway
100190818 (GNG4)
09156 Nervous system
04724 Glutamatergic synapse
100190818 (GNG4)
04727 GABAergic synapse
100190818 (GNG4)
04725 Cholinergic synapse
100190818 (GNG4)
04728 Dopaminergic synapse
100190818 (GNG4)
04726 Serotonergic synapse
100190818 (GNG4)
04723 Retrograde endocannabinoid signaling
100190818 (GNG4)
09159 Environmental adaptation
04713 Circadian entrainment
100190818 (GNG4)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
100190818 (GNG4)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
100190818 (GNG4)
05163 Human cytomegalovirus infection
100190818 (GNG4)
05167 Kaposi sarcoma-associated herpesvirus infection
100190818 (GNG4)
09165 Substance dependence
05032 Morphine addiction
100190818 (GNG4)
05034 Alcoholism
100190818 (GNG4)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04031 GTP-binding proteins [BR:pon04031]
100190818 (GNG4)
GTP-binding proteins [BR:pon04031]
Heterotrimeric G-proteins
Gamma Subunits
Gamma [OT]
100190818 (GNG4)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| Position |
1:13612019..13717869
|
|---|
| AA seq |
75 aa
MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA
SENPFREKKFFCTIL |
|---|
| NT seq |
228 nt +upstreamnt +downstreamnt
atgaaagagggcatgtctaataacagcaccactagcatctcccaagccaggaaagctgtg
gagcagctaaagatggaagcctgtatggacagggtcaaggtctcccaggcagctgcggac
ctcctggcctactgtgaagctcacgtgcgggaagaccctctcatcattccagtgcctgcg
tcagaaaacccctttcgcgagaagaagttcttttgtaccattctctaa |
|---|
