Pongo abelii (Sumatran orangutan): 100441074 Help Entry 100441074         CDS       T01416                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04380   Osteoclast differentiation pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon04668   TNF signaling pathway pon04936   Alcoholic liver disease pon05135   Yersinia infection pon05142   Chagas disease pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100441074 (IFNB1)    04668 TNF signaling pathway     100441074 (IFNB1)    04151 PI3K-Akt signaling pathway     100441074 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100441074 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100441074 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100441074 (IFNB1)    04621 NOD-like receptor signaling pathway     100441074 (IFNB1)    04622 RIG-I-like receptor signaling pathway     100441074 (IFNB1)    04623 Cytosolic DNA-sensing pathway     100441074 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     100441074 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     100441074 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100441074 (IFNB1)    05161 Hepatitis B     100441074 (IFNB1)    05160 Hepatitis C     100441074 (IFNB1)    05171 Coronavirus disease - COVID-19     100441074 (IFNB1)    05164 Influenza A     100441074 (IFNB1)    05162 Measles     100441074 (IFNB1)    05168 Herpes simplex virus 1 infection     100441074 (IFNB1)    05163 Human cytomegalovirus infection     100441074 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     100441074 (IFNB1)    05169 Epstein-Barr virus infection     100441074 (IFNB1)    05165 Human papillomavirus infection     100441074 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     100441074 (IFNB1)    05152 Tuberculosis     100441074 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     100441074 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100441074 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100441074 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100441074 (IFNB1) Cytokines and neuropeptides [BR:pon04052]  Cytokines   Interferons    100441074 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Forkhead Motif Other DBs NCBI-GeneID:  100441074 NCBI-ProteinID:  XP_002819803 Ensembl:  ENSPPYG00000019185 UniProt:  H2PS27 LinkDB All DBs Position 13:37079886..37080721 Genome browser AA seq 187 aa AA seqDB search MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSSFQCQKLLWQLNGRFEYCLKDRMNFD IPKEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK TVLEEKLEKEYFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINR LTGYLRN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctctt tccatgagctacaacttgcttggattcctacaaagaagcagcagttttcagtgtcagaag ctcctgtggcaattgaatgggaggtttgaatattgcctcaaggacaggatgaactttgac atccctaaggagattaagcagctgcagcagttccagaaggaggacgcggcattgaccatc tacgagatgctccagaacatctttgctattttcagacaagattcatctagcactggctgg aatgagactattgttgagaacctccttgctaatgtctatcatcagataaaccatctgaag acagttctggaagaaaaactggagaaagaatatttcaccaggggaaaattcatgagcagt ctgcacctgaaaagatattatgggaggattctgcattacctgaaggccaaggagtacagt cactgtgcctggaccatagtcagagtggaaatcctcaggaactttttcttcattaacaga cttacaggttacctccgaaactga

DBGET integrated database retrieval system