Pongo abelii (Sumatran orangutan): 100441387 Help Entry 100441387         CDS       T01416                                  Symbol ACTG1 Name (RefSeq) actin, cytoplasmic 2 isoform X2   KO K05692   actin beta/gamma 1 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon03082   ATP-dependent chromatin remodeling pon04015   Rap1 signaling pathway pon04145   Phagosome pon04210   Apoptosis pon04390   Hippo signaling pathway pon04510   Focal adhesion pon04520   Adherens junction pon04530   Tight junction pon04611   Platelet activation pon04613   Neutrophil extracellular trap formation pon04670   Leukocyte transendothelial migration pon04714   Thermogenesis pon04810   Regulation of actin cytoskeleton pon04814   Motor proteins pon04820   Cytoskeleton in muscle cells pon04919   Thyroid hormone signaling pathway pon04921   Oxytocin signaling pathway pon04971   Gastric acid secretion pon05014   Amyotrophic lateral sclerosis pon05100   Bacterial invasion of epithelial cells pon05132   Salmonella infection pon05135   Yersinia infection pon05164   Influenza A pon05205   Proteoglycans in cancer pon05225   Hepatocellular carcinoma pon05410   Hypertrophic cardiomyopathy pon05412   Arrhythmogenic right ventricular cardiomyopathy pon05414   Dilated cardiomyopathy pon05416   Viral myocarditis pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100441387 (ACTG1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100441387 (ACTG1)    04390 Hippo signaling pathway     100441387 (ACTG1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100441387 (ACTG1)   09143 Cell growth and death    04210 Apoptosis     100441387 (ACTG1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100441387 (ACTG1)    04520 Adherens junction     100441387 (ACTG1)    04530 Tight junction     100441387 (ACTG1)   09142 Cell motility    04814 Motor proteins     100441387 (ACTG1)    04820 Cytoskeleton in muscle cells     100441387 (ACTG1)    04810 Regulation of actin cytoskeleton     100441387 (ACTG1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100441387 (ACTG1)    04613 Neutrophil extracellular trap formation     100441387 (ACTG1)    04670 Leukocyte transendothelial migration     100441387 (ACTG1)   09152 Endocrine system    04921 Oxytocin signaling pathway     100441387 (ACTG1)    04919 Thyroid hormone signaling pathway     100441387 (ACTG1)   09154 Digestive system    04971 Gastric acid secretion     100441387 (ACTG1)   09159 Environmental adaptation    04714 Thermogenesis     100441387 (ACTG1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100441387 (ACTG1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100441387 (ACTG1)   09172 Infectious disease: viral    05164 Influenza A     100441387 (ACTG1)   09171 Infectious disease: bacterial    05132 Salmonella infection     100441387 (ACTG1)    05135 Yersinia infection     100441387 (ACTG1)    05100 Bacterial invasion of epithelial cells     100441387 (ACTG1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100441387 (ACTG1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100441387 (ACTG1)    05410 Hypertrophic cardiomyopathy     100441387 (ACTG1)    05412 Arrhythmogenic right ventricular cardiomyopathy     100441387 (ACTG1)    05414 Dilated cardiomyopathy     100441387 (ACTG1)    05416 Viral myocarditis     100441387 (ACTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pon03021]     100441387 (ACTG1)    03019 Messenger RNA biogenesis [BR:pon03019]     100441387 (ACTG1)    03036 Chromosome and associated proteins [BR:pon03036]     100441387 (ACTG1)    03029 Mitochondrial biogenesis [BR:pon03029]     100441387 (ACTG1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pon04812]     100441387 (ACTG1)    04147 Exosome [BR:pon04147]     100441387 (ACTG1) Transcription machinery [BR:pon03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      100441387 (ACTG1) Messenger RNA biogenesis [BR:pon03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100441387 (ACTG1) Chromosome and associated proteins [BR:pon03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      100441387 (ACTG1)     NuA4 complex      100441387 (ACTG1)   Chromatin remodeling factors    BAF complex     100441387 (ACTG1)    PBAF complex     100441387 (ACTG1)    GBAF(ncBAF) complex     100441387 (ACTG1)    SWR1 complex     100441387 (ACTG1) Mitochondrial biogenesis [BR:pon03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     100441387 (ACTG1) Cytoskeleton proteins [BR:pon04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      100441387 (ACTG1) Exosome [BR:pon04147]  Exosomal proteins   Proteins found in most exosomes    100441387 (ACTG1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  100441387 NCBI-ProteinID:  XP_009250409 Ensembl:  ENSPPYG00000008735 UniProt:  A0A6D2XWB9 LinkDB All DBs Position 19:complement(96984856..96987745) Genome browser AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaagagatcgccgcgctcgtcattgacaatggctccggcatgtgcaaagctggc tttgctggggacgacgctccccgagccgtgtttccttccatcgtcgggcgccccagacac cagggcgtgatggtgggcatgggccagaaggactcctacgtgggcgacgaggcccagagc aagcgtggcatcctgaccctgaagtaccctatcgagcatggcatcgtcaccaactgggac gacatggagaagatctggcaccacactttctacaacgagctgcgcgtggctccggaggag catccagtgctgctgaccgaggcccccctgaaccccaaggccaacagagagaagatgact cagattatgtttgagaccttcaacaccccggccatgtacgtggccatccaggccgtgctg tccctctacgcttctgggcgcaccactggcattgtcatggactctggagacggggtcacc cacacggtgcccatctacgagggctacgccctcccccacgctatcctgcgtctggacctg gctggccgggacctgaccgactacctcatgaagatcctcaccgagcgaggctacagcttc accaccacggccgagcgggaaatcgtgcgcgacatcaaggaaaagctgtgctacgtcgcc ctggatttcgagcaggagatggccaccgccgcatcctcctcttcgctggagaagagctac gagctgcctgatggccaggtcatcaccattggcaatgagcggttccggtgtccggaggcg ctgttccagccttctttcttgggcatggaatcttgcggcatccacgagaccaccttcaac tccattatgaagtgtgacgtggatatccgcaaagacctgtacgccaacacggtgctgtcc ggcggcaccaccatgtacccaggcattgccgacaggatgcagaaggagatcactgccctg gcgcccagtaccatgaagatcaagatcattgcacccccagagcgcaagtactcagtgtgg atcggcggctccatcctggcctcactgtccaccttccagcagatgtggattagcaagcag gagtacgacgagtcgggcccctccatcgtccatcgcaaatgcttctaa

DBGET integrated database retrieval system