Pongo abelii (Sumatran orangutan): 100444043 Help Entry 100444043         CDS       T01416                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon03050   Proteasome pon04060   Cytokine-cytokine receptor interaction pon04066   HIF-1 signaling pathway pon04217   Necroptosis pon04350   TGF-beta signaling pathway pon04380   Osteoclast differentiation pon04612   Antigen processing and presentation pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon04657   IL-17 signaling pathway pon04658   Th1 and Th2 cell differentiation pon04659   Th17 cell differentiation pon04660   T cell receptor signaling pathway pon04940   Type I diabetes mellitus pon05140   Leishmaniasis pon05142   Chagas disease pon05143   African trypanosomiasis pon05144   Malaria pon05145   Toxoplasmosis pon05146   Amoebiasis pon05152   Tuberculosis pon05160   Hepatitis C pon05164   Influenza A pon05168   Herpes simplex virus 1 infection pon05200   Pathways in cancer pon05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pon05321   Inflammatory bowel disease pon05322   Systemic lupus erythematosus pon05323   Rheumatoid arthritis pon05330   Allograft rejection pon05332   Graft-versus-host disease pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     100444043 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     100444043 (IFNG)    04630 JAK-STAT signaling pathway     100444043 (IFNG)    04066 HIF-1 signaling pathway     100444043 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100444043 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100444043 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     100444043 (IFNG)    04612 Antigen processing and presentation     100444043 (IFNG)    04660 T cell receptor signaling pathway     100444043 (IFNG)    04658 Th1 and Th2 cell differentiation     100444043 (IFNG)    04659 Th17 cell differentiation     100444043 (IFNG)    04657 IL-17 signaling pathway     100444043 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     100444043 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100444043 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100444043 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     100444043 (IFNG)    05164 Influenza A     100444043 (IFNG)    05168 Herpes simplex virus 1 infection     100444043 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     100444043 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     100444043 (IFNG)    05144 Malaria     100444043 (IFNG)    05145 Toxoplasmosis     100444043 (IFNG)    05140 Leishmaniasis     100444043 (IFNG)    05142 Chagas disease     100444043 (IFNG)    05143 African trypanosomiasis     100444043 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     100444043 (IFNG)    05323 Rheumatoid arthritis     100444043 (IFNG)    05321 Inflammatory bowel disease     100444043 (IFNG)    05330 Allograft rejection     100444043 (IFNG)    05332 Graft-versus-host disease     100444043 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100444043 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100444043 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:pon03051]     100444043 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100444043 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:pon00536]     100444043 (IFNG) Proteasome [BR:pon03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     100444043 (IFNG) Cytokines and neuropeptides [BR:pon04052]  Cytokines   Interferons    100444043 (IFNG) Glycosaminoglycan binding proteins [BR:pon00536]  Heparan sulfate / Heparin   Cytokines    100444043 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma API5 NolX Tup_N Motif Other DBs NCBI-GeneID:  100444043 NCBI-ProteinID:  XP_002823542 Ensembl:  ENSPPYG00000004747 UniProt:  H2NHZ4 LinkDB All DBs Position 10:complement(66145481..66150507) Genome browser AA seq 166 aa AA seqDB search MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGDSDVADNGTLFLGILKNWK EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatatacaagttatatcttggcttttcaactctgcatcgttttgggttctcttggc tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaacgca ggtgattcagatgtagcggataatggaactcttttcttaggcattttgaagaattggaaa gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt aaaaactttaaagatgaccagagcatccaaaagagtgtggagaccatcaaggaagacatg aatgtcaagtttttcaatagcaacaaaaagaaacgggatgacttcgaaaagctgactaat tattcggtaactgacttgaacgtccaacgcaaagcaatacatgaactcatccaagtgatg gctgaactgtcgccagcagctaaaacagggaagcggaaaaggagtcagatgctgtttcga ggtcgaagagcatcccagtaa

DBGET integrated database retrieval system