Pongo abelii (Sumatran orangutan): 100447558 Help Entry 100447558         CDS       T01416                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon01523   Antifolate resistance pon04010   MAPK signaling pathway pon04060   Cytokine-cytokine receptor interaction pon04061   Viral protein interaction with cytokine and cytokine receptor pon04064   NF-kappa B signaling pathway pon04071   Sphingolipid signaling pathway pon04150   mTOR signaling pathway pon04210   Apoptosis pon04217   Necroptosis pon04350   TGF-beta signaling pathway pon04380   Osteoclast differentiation pon04612   Antigen processing and presentation pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04625   C-type lectin receptor signaling pathway pon04640   Hematopoietic cell lineage pon04650   Natural killer cell mediated cytotoxicity pon04657   IL-17 signaling pathway pon04660   T cell receptor signaling pathway pon04664   Fc epsilon RI signaling pathway pon04668   TNF signaling pathway pon04920   Adipocytokine signaling pathway pon04930   Type II diabetes mellitus pon04931   Insulin resistance pon04932   Non-alcoholic fatty liver disease pon04933   AGE-RAGE signaling pathway in diabetic complications pon04936   Alcoholic liver disease pon04940   Type I diabetes mellitus pon05010   Alzheimer disease pon05014   Amyotrophic lateral sclerosis pon05020   Prion disease pon05022   Pathways of neurodegeneration - multiple diseases pon05132   Salmonella infection pon05133   Pertussis pon05134   Legionellosis pon05135   Yersinia infection pon05140   Leishmaniasis pon05142   Chagas disease pon05143   African trypanosomiasis pon05144   Malaria pon05145   Toxoplasmosis pon05146   Amoebiasis pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05166   Human T-cell leukemia virus 1 infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05205   Proteoglycans in cancer pon05310   Asthma pon05321   Inflammatory bowel disease pon05322   Systemic lupus erythematosus pon05323   Rheumatoid arthritis pon05330   Allograft rejection pon05332   Graft-versus-host disease pon05410   Hypertrophic cardiomyopathy pon05414   Dilated cardiomyopathy pon05417   Lipid and atherosclerosis pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100447558 (TNF)    04350 TGF-beta signaling pathway     100447558 (TNF)    04064 NF-kappa B signaling pathway     100447558 (TNF)    04668 TNF signaling pathway     100447558 (TNF)    04071 Sphingolipid signaling pathway     100447558 (TNF)    04150 mTOR signaling pathway     100447558 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100447558 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     100447558 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100447558 (TNF)    04217 Necroptosis     100447558 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100447558 (TNF)    04620 Toll-like receptor signaling pathway     100447558 (TNF)    04621 NOD-like receptor signaling pathway     100447558 (TNF)    04622 RIG-I-like receptor signaling pathway     100447558 (TNF)    04625 C-type lectin receptor signaling pathway     100447558 (TNF)    04650 Natural killer cell mediated cytotoxicity     100447558 (TNF)    04612 Antigen processing and presentation     100447558 (TNF)    04660 T cell receptor signaling pathway     100447558 (TNF)    04657 IL-17 signaling pathway     100447558 (TNF)    04664 Fc epsilon RI signaling pathway     100447558 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100447558 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     100447558 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100447558 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100447558 (TNF)    05170 Human immunodeficiency virus 1 infection     100447558 (TNF)    05161 Hepatitis B     100447558 (TNF)    05160 Hepatitis C     100447558 (TNF)    05171 Coronavirus disease - COVID-19     100447558 (TNF)    05164 Influenza A     100447558 (TNF)    05168 Herpes simplex virus 1 infection     100447558 (TNF)    05163 Human cytomegalovirus infection     100447558 (TNF)    05169 Epstein-Barr virus infection     100447558 (TNF)    05165 Human papillomavirus infection     100447558 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     100447558 (TNF)    05135 Yersinia infection     100447558 (TNF)    05133 Pertussis     100447558 (TNF)    05134 Legionellosis     100447558 (TNF)    05152 Tuberculosis     100447558 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     100447558 (TNF)    05144 Malaria     100447558 (TNF)    05145 Toxoplasmosis     100447558 (TNF)    05140 Leishmaniasis     100447558 (TNF)    05142 Chagas disease     100447558 (TNF)    05143 African trypanosomiasis     100447558 (TNF)   09163 Immune disease    05310 Asthma     100447558 (TNF)    05322 Systemic lupus erythematosus     100447558 (TNF)    05323 Rheumatoid arthritis     100447558 (TNF)    05321 Inflammatory bowel disease     100447558 (TNF)    05330 Allograft rejection     100447558 (TNF)    05332 Graft-versus-host disease     100447558 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     100447558 (TNF)    05014 Amyotrophic lateral sclerosis     100447558 (TNF)    05020 Prion disease     100447558 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     100447558 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100447558 (TNF)    05418 Fluid shear stress and atherosclerosis     100447558 (TNF)    05410 Hypertrophic cardiomyopathy     100447558 (TNF)    05414 Dilated cardiomyopathy     100447558 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100447558 (TNF)    04940 Type I diabetes mellitus     100447558 (TNF)    04936 Alcoholic liver disease     100447558 (TNF)    04932 Non-alcoholic fatty liver disease     100447558 (TNF)    04931 Insulin resistance     100447558 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     100447558 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100447558 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100447558 (TNF)    00536 Glycosaminoglycan binding proteins [BR:pon00536]     100447558 (TNF) Cytokines and neuropeptides [BR:pon04052]  Cytokines   Tumor necrosis fators    100447558 (TNF) Glycosaminoglycan binding proteins [BR:pon00536]  Heparan sulfate / Heparin   Cytokines    100447558 (TNF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  100447558 NCBI-ProteinID:  XP_002816766 Ensembl:  ENSPPYG00000016437 UniProt:  H2PII1 LinkDB All DBs Position 5:31789492..31792292 Genome browser AA seq 233 aa AA seqDB search MSTESMIRDVELAEEALPKKTGGPHGSRRCLFLSLVSFLIVAGATTLFCLLHFGVIGPQR EEFPKDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TTEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaag acaggggggccccatggctccaggcggtgcttgttcctcagcctcgtctccttcctgatc gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg gaagagttccccaaggacctctctctaatcagccctctggcccaggcagtcagatcatct tctcgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgaga gataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttc aagggccaaggctgcccctccacccatgtgctcctcacccacaccatcagccgcatcgcc gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag accacagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtcttc cagctggagaagggtgatcgactcagcgctgagatcaatctgcccaactatctcgacttt gccgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system