Pongo abelii (Sumatran orangutan): 100451705 Help Entry 100451705         CDS       T01416                                  Symbol IL4 Name (RefSeq) interleukin-4 isoform X1   KO K05430   interleukin 4 Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04630   JAK-STAT signaling pathway pon04640   Hematopoietic cell lineage pon04657   IL-17 signaling pathway pon04658   Th1 and Th2 cell differentiation pon04659   Th17 cell differentiation pon04660   T cell receptor signaling pathway pon04664   Fc epsilon RI signaling pathway pon04672   Intestinal immune network for IgA production pon05140   Leishmaniasis pon05200   Pathways in cancer pon05310   Asthma pon05320   Autoimmune thyroid disease pon05321   Inflammatory bowel disease pon05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100451705 (IL4)    04151 PI3K-Akt signaling pathway     100451705 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100451705 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100451705 (IL4)    04660 T cell receptor signaling pathway     100451705 (IL4)    04658 Th1 and Th2 cell differentiation     100451705 (IL4)    04659 Th17 cell differentiation     100451705 (IL4)    04657 IL-17 signaling pathway     100451705 (IL4)    04664 Fc epsilon RI signaling pathway     100451705 (IL4)    04672 Intestinal immune network for IgA production     100451705 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100451705 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100451705 (IL4)   09163 Immune disease    05310 Asthma     100451705 (IL4)    05320 Autoimmune thyroid disease     100451705 (IL4)    05321 Inflammatory bowel disease     100451705 (IL4)    05330 Allograft rejection     100451705 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100451705 (IL4)    00536 Glycosaminoglycan binding proteins [BR:pon00536]     100451705 (IL4) Cytokines and neuropeptides [BR:pon04052]  Cytokines   Interleukins    100451705 (IL4) Glycosaminoglycan binding proteins [BR:pon00536]  Heparan sulfate / Heparin   Cytokines    100451705 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Mannosyl_trans3 Tfb5 Motif Other DBs NCBI-GeneID:  100451705 NCBI-ProteinID:  XP_002815914 Ensembl:  ENSPPYG00000015766 UniProt:  H2PGI4 LinkDB All DBs Position 4:141044278..141052799 Genome browser AA seq 153 aa AA seqDB search MGLTSQLLPPLFFLLACAGNFVHGHKCDIALQEIIKTLNSLTEQKTLCTELTVTDIFAAS KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL NSCPVKEANQSTLEDFLERLKTIMREKYSKCSS NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac tttgtccatggacacaagtgcgatatcgccttacaagagatcatcaaaactttgaacagc ctcacagagcagaagactctgtgcaccgagttgaccgtaacggacatctttgctgcctcc aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac agccaccatgagaaggacactcgctgtctgggtgcgactgcacagcagttccacagacac aagcagctcatccgattcctgaaacggctcgacaggaacctctggggcctggcgggtttg aattcctgtcctgtgaaggaagccaaccagagtacgttggaagacttcttggaaaggcta aagacgatcatgagagaaaaatattcaaagtgttcgagctga

DBGET integrated database retrieval system