Populus trichocarpa (black cottonwood): 7469218 Help Entry 7469218           CDS       T01077                                  Name (RefSeq) sm-like protein LSM3B   KO K12622   U6 snRNA-associated Sm-like protein LSm3 Organism pop  Populus trichocarpa (black cottonwood) Pathway pop03018   RNA degradation pop03040   Spliceosome Brite KEGG Orthology (KO) [BR:pop00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     7469218   09123 Folding, sorting and degradation    03018 RNA degradation     7469218  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pop03019]     7469218    03041 Spliceosome [BR:pop03041]     7469218 Messenger RNA biogenesis [BR:pop03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      7469218   mRNA degradation factors    5'-3' decay     Lsm complex      7469218 Spliceosome [BR:pop03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     7469218  Complex C   U2 snRNP components     7469218 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM TIG_SUH Glutaredoxin Motif Other DBs NCBI-GeneID:  7469218 NCBI-ProteinID:  XP_002307496 UniProt:  B9H7R8 LinkDB All DBs Position 5:complement(19892919..19895123) Genome browser AA seq 97 aa AA seqDB search MASEEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEEIVTTVE IDDETYEEIVRTTRRTVPFLFVRGDGVILVSPPLRTA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcaagcgaagaagagagtgcggtaaaagaaccattggatctcatcagacttagcctg gacgagcgtatctacgtcaagctccgctctgatcgtgagcttcgcggcaaacttcacgct tatgatcagcatttgaatatgattcttggggatgttgaagaaattgttactacagtagaa atcgatgatgaaacctatgaagagattgttcggactacaaggcgcacagtacccttcctg tttgttagaggagatggtgtcatattggtctctcctccattgaggacagcttaa

DBGET integrated database retrieval system