Populus trichocarpa (black cottonwood): 7471662 Help Entry 7471662           CDS       T01077                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pop  Populus trichocarpa (black cottonwood) Pathway pop03420   Nucleotide excision repair pop04120   Ubiquitin mediated proteolysis pop04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pop00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     7471662    04120 Ubiquitin mediated proteolysis     7471662   09124 Replication and repair    03420 Nucleotide excision repair     7471662  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pop04121]     7471662    03400 DNA repair and recombination proteins [BR:pop03400]     7471662 Enzymes [BR:pop01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      7471662 Ubiquitin system [BR:pop04121]  Ubiquitin ligases (E3)   UBL E3 ligases    7471662   Multi subunit type E3    SCF complex     Ring finger protein      7471662    Cul2 complex      7471662    Cul3 complex      7471662    Cul4 complex      7471662    Cul7 complex      7471662    Cul8 complex      7471662    Cul9 complex      7471662 DNA repair and recombination proteins [BR:pop03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       7471662     TCR (transcription coupled repair) factors      Cul4-CSA complex       7471662 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  7471662 NCBI-ProteinID:  XP_002304312 UniProt:  A9PDQ0 LinkDB All DBs Position 3:complement(9437687..9440234) Genome browser AA seq 110 aa AA seqDB search MDTDVTMVPAGEASSSSSRKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQA NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggacacggacgtgacgatggttccggcaggcgaggcaagctcctcttcctcaaggaaa ccgaagcgattcgaaattaagaagtggaatgctgttgctctttgggcttgggatattgtg gtggataactgcgctatttgtagaaaccatatcatggatctttgcattgagtgccaagca aatcaagctagtgctacaagcgaggagtgcactgttgcctggggtgtgtgcaaccatgcc ttccacttccactgtatcagccggtggctcaaaacccgccaagtgtgtcctctcgataat agcgagtgggagtttcagaagtatggccactaa

DBGET integrated database retrieval system