Panthera pardus (leopard): 109246558 Help Entry 109246558         CDS       T06062                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism ppad  Panthera pardus (leopard) Pathway ppad00510   N-Glycan biosynthesis ppad00513   Various types of N-glycan biosynthesis ppad04141   Protein processing in endoplasmic reticulum Module ppad_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ppad00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     109246558 (TMEM258)    00513 Various types of N-glycan biosynthesis     109246558 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109246558 (TMEM258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  109246558 NCBI-ProteinID:  XP_019270185 Ensembl:  ENSPPRG00000013362 UniProt:  A0A9V1DYC9 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatacaccagcccagtgaacccagctgtcttcccccat ctgaccgtggtgctgttggccattggcatgttctttaccgcctggttcttcgtctatgag gtgacctccaccaagtacactcgggatatctacaaagagctcctcatctccttggtggcc tcgcttttcatgggctttggagttctcttcctgctgctctgggtcggcatctacgtgtga

DBGET integrated database retrieval system