Panthera pardus (leopard): 109247124 Help Entry 109247124         CDS       T06062                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism ppad  Panthera pardus (leopard) Pathway ppad04060   Cytokine-cytokine receptor interaction ppad04151   PI3K-Akt signaling pathway ppad04217   Necroptosis ppad04380   Osteoclast differentiation ppad04620   Toll-like receptor signaling pathway ppad04621   NOD-like receptor signaling pathway ppad04622   RIG-I-like receptor signaling pathway ppad04623   Cytosolic DNA-sensing pathway ppad04630   JAK-STAT signaling pathway ppad04650   Natural killer cell mediated cytotoxicity ppad04668   TNF signaling pathway ppad04936   Alcoholic liver disease ppad05135   Yersinia infection ppad05142   Chagas disease ppad05152   Tuberculosis ppad05160   Hepatitis C ppad05161   Hepatitis B ppad05162   Measles ppad05163   Human cytomegalovirus infection ppad05164   Influenza A ppad05165   Human papillomavirus infection ppad05167   Kaposi sarcoma-associated herpesvirus infection ppad05168   Herpes simplex virus 1 infection ppad05169   Epstein-Barr virus infection ppad05170   Human immunodeficiency virus 1 infection ppad05171   Coronavirus disease - COVID-19 ppad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109247124 (IFNB1)    04668 TNF signaling pathway     109247124 (IFNB1)    04151 PI3K-Akt signaling pathway     109247124 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109247124 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109247124 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109247124 (IFNB1)    04621 NOD-like receptor signaling pathway     109247124 (IFNB1)    04622 RIG-I-like receptor signaling pathway     109247124 (IFNB1)    04623 Cytosolic DNA-sensing pathway     109247124 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     109247124 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     109247124 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109247124 (IFNB1)    05161 Hepatitis B     109247124 (IFNB1)    05160 Hepatitis C     109247124 (IFNB1)    05171 Coronavirus disease - COVID-19     109247124 (IFNB1)    05164 Influenza A     109247124 (IFNB1)    05162 Measles     109247124 (IFNB1)    05168 Herpes simplex virus 1 infection     109247124 (IFNB1)    05163 Human cytomegalovirus infection     109247124 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     109247124 (IFNB1)    05169 Epstein-Barr virus infection     109247124 (IFNB1)    05165 Human papillomavirus infection     109247124 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     109247124 (IFNB1)    05152 Tuberculosis     109247124 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     109247124 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109247124 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     109247124 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppad04052]     109247124 (IFNB1) Cytokines and neuropeptides [BR:ppad04052]  Cytokines   Interferons    109247124 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  109247124 NCBI-ProteinID:  XP_019271113 Ensembl:  ENSPPRG00000021934 UniProt:  A0A9V1DZY2 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MTGRCILQIALLACFFTTVHSVSYKLLGFQLRSSSLECQELLLNLNRTSKYCLKDRMNFE VPEEIKKSQRFQKEEAILVINEMFQKIFNIFSRNTSSTGWNETTVENLLATLHWQKEHLE TILEEIMEEENFTWDNTTLLHLKKYYLRIVRYLKAKEYSICAWTVVQAEILRNFFFLERL TDYLQN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccggcaggtgcatcctccaaatcgctctcttggcgtgtttcttcaccaccgtgcat tccgtgagctacaagttgcttggattccaactaagaagcagcagtttggagtgtcaggag ctcctgctgaacttgaacagaacctctaaatattgcctcaaggacaggatgaacttcgag gtccctgaggagattaaaaaatcacagcggttccagaaggaggaagccatattggtcatc aacgagatgttccagaagatctttaatattttcagtagaaacacctctagcacgggatgg aatgagaccactgttgagaacctccttgcgacactccactggcagaaggaacacctggaa acgatcctggaggaaatcatggaggaggaaaacttcacctgggacaatacgacccttctg cacctgaagaaatactacttaaggatcgtgcggtacctgaaggccaaggagtacagcatc tgtgcctggacagtagtccaagcagaaatcctcaggaactttttcttccttgagagactt acagattatctccaaaactga

DBGET integrated database retrieval system