Panthera pardus (leopard): 109250887 Help Entry 109250887         CDS       T06062                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism ppad  Panthera pardus (leopard) Pathway ppad04060   Cytokine-cytokine receptor interaction ppad04151   PI3K-Akt signaling pathway ppad04630   JAK-STAT signaling pathway ppad04640   Hematopoietic cell lineage ppad04657   IL-17 signaling pathway ppad04658   Th1 and Th2 cell differentiation ppad04659   Th17 cell differentiation ppad04660   T cell receptor signaling pathway ppad04664   Fc epsilon RI signaling pathway ppad04672   Intestinal immune network for IgA production ppad05140   Leishmaniasis ppad05200   Pathways in cancer ppad05310   Asthma ppad05320   Autoimmune thyroid disease ppad05321   Inflammatory bowel disease ppad05330   Allograft rejection Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109250887 (IL4)    04151 PI3K-Akt signaling pathway     109250887 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109250887 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109250887 (IL4)    04660 T cell receptor signaling pathway     109250887 (IL4)    04658 Th1 and Th2 cell differentiation     109250887 (IL4)    04659 Th17 cell differentiation     109250887 (IL4)    04657 IL-17 signaling pathway     109250887 (IL4)    04664 Fc epsilon RI signaling pathway     109250887 (IL4)    04672 Intestinal immune network for IgA production     109250887 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109250887 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     109250887 (IL4)   09163 Immune disease    05310 Asthma     109250887 (IL4)    05320 Autoimmune thyroid disease     109250887 (IL4)    05321 Inflammatory bowel disease     109250887 (IL4)    05330 Allograft rejection     109250887 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppad04052]     109250887 (IL4)    00536 Glycosaminoglycan binding proteins [BR:ppad00536]     109250887 (IL4) Cytokines and neuropeptides [BR:ppad04052]  Cytokines   Interleukins    109250887 (IL4) Glycosaminoglycan binding proteins [BR:ppad00536]  Heparan sulfate / Heparin   Cytokines    109250887 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 HHH_9 Ribosomal_S19e AAR2 FAD_SOX Motif Other DBs NCBI-GeneID:  109250887 NCBI-ProteinID:  XP_019277590 UniProt:  A0A9V1EAQ2 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MDLTSQLIPALVCLLAFTSTFVHGQNFNNTLKEIIKTLNILTARNDSCMELTVMDVLAAP KNTSDKEIFCRATTVLRQIYTHHNCSTKFLKGLDRNLSSMANRTCSVNEVKKSTLKDFLE RLKAIMQKKYSKQ NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggatctcacctcccaactgattccagctctggtctgcttactagcatttaccagcacc ttcgtccacggccagaacttcaataatacgttgaaagagatcatcaaaacgttgaacatc ctcacagcgagaaacgactcgtgcatggagctgactgtcatggacgtcttggcagcccca aagaacacaagtgacaaggaaatcttctgcagagccacaaccgtgctccggcagatctat acacaccacaactgctccaccaaattcctcaaaggactcgacaggaacctcagcagcatg gcaaacaggacctgttctgtgaatgaagtcaagaagagtacactgaaagacttcttggaa aggctaaaagcgatcatgcaaaagaaatactcaaagcaatga

DBGET integrated database retrieval system