Panthera pardus (leopard): 109251167 Help Entry 109251167         CDS       T06062                                  Symbol ACTB Name (RefSeq) actin, cytoplasmic 1   KO K05692   actin beta/gamma 1 Organism ppad  Panthera pardus (leopard) Pathway ppad03082   ATP-dependent chromatin remodeling ppad04015   Rap1 signaling pathway ppad04145   Phagosome ppad04210   Apoptosis ppad04390   Hippo signaling pathway ppad04510   Focal adhesion ppad04520   Adherens junction ppad04530   Tight junction ppad04611   Platelet activation ppad04613   Neutrophil extracellular trap formation ppad04670   Leukocyte transendothelial migration ppad04714   Thermogenesis ppad04810   Regulation of actin cytoskeleton ppad04814   Motor proteins ppad04820   Cytoskeleton in muscle cells ppad04919   Thyroid hormone signaling pathway ppad04921   Oxytocin signaling pathway ppad04971   Gastric acid secretion ppad05014   Amyotrophic lateral sclerosis ppad05100   Bacterial invasion of epithelial cells ppad05132   Salmonella infection ppad05135   Yersinia infection ppad05164   Influenza A ppad05205   Proteoglycans in cancer ppad05225   Hepatocellular carcinoma ppad05410   Hypertrophic cardiomyopathy ppad05412   Arrhythmogenic right ventricular cardiomyopathy ppad05414   Dilated cardiomyopathy ppad05416   Viral myocarditis ppad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     109251167 (ACTB)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     109251167 (ACTB)    04390 Hippo signaling pathway     109251167 (ACTB)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     109251167 (ACTB)   09143 Cell growth and death    04210 Apoptosis     109251167 (ACTB)   09144 Cellular community - eukaryotes    04510 Focal adhesion     109251167 (ACTB)    04520 Adherens junction     109251167 (ACTB)    04530 Tight junction     109251167 (ACTB)   09142 Cell motility    04814 Motor proteins     109251167 (ACTB)    04820 Cytoskeleton in muscle cells     109251167 (ACTB)    04810 Regulation of actin cytoskeleton     109251167 (ACTB)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     109251167 (ACTB)    04613 Neutrophil extracellular trap formation     109251167 (ACTB)    04670 Leukocyte transendothelial migration     109251167 (ACTB)   09152 Endocrine system    04921 Oxytocin signaling pathway     109251167 (ACTB)    04919 Thyroid hormone signaling pathway     109251167 (ACTB)   09154 Digestive system    04971 Gastric acid secretion     109251167 (ACTB)   09159 Environmental adaptation    04714 Thermogenesis     109251167 (ACTB)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     109251167 (ACTB)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     109251167 (ACTB)   09172 Infectious disease: viral    05164 Influenza A     109251167 (ACTB)   09171 Infectious disease: bacterial    05132 Salmonella infection     109251167 (ACTB)    05135 Yersinia infection     109251167 (ACTB)    05100 Bacterial invasion of epithelial cells     109251167 (ACTB)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     109251167 (ACTB)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109251167 (ACTB)    05410 Hypertrophic cardiomyopathy     109251167 (ACTB)    05412 Arrhythmogenic right ventricular cardiomyopathy     109251167 (ACTB)    05414 Dilated cardiomyopathy     109251167 (ACTB)    05416 Viral myocarditis     109251167 (ACTB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ppad03021]     109251167 (ACTB)    03019 Messenger RNA biogenesis [BR:ppad03019]     109251167 (ACTB)    03036 Chromosome and associated proteins [BR:ppad03036]     109251167 (ACTB)    03029 Mitochondrial biogenesis [BR:ppad03029]     109251167 (ACTB)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ppad04812]     109251167 (ACTB)    04147 Exosome [BR:ppad04147]     109251167 (ACTB) Transcription machinery [BR:ppad03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      109251167 (ACTB) Messenger RNA biogenesis [BR:ppad03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      109251167 (ACTB) Chromosome and associated proteins [BR:ppad03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      109251167 (ACTB)     NuA4 complex      109251167 (ACTB)   Chromatin remodeling factors    BAF complex     109251167 (ACTB)    PBAF complex     109251167 (ACTB)    GBAF(ncBAF) complex     109251167 (ACTB)    SWR1 complex     109251167 (ACTB) Mitochondrial biogenesis [BR:ppad03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     109251167 (ACTB) Cytoskeleton proteins [BR:ppad04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      109251167 (ACTB) Exosome [BR:ppad04147]  Exosomal proteins   Proteins found in most exosomes    109251167 (ACTB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  109251167 NCBI-ProteinID:  XP_019278078 Ensembl:  ENSPPRG00000004533 LinkDB All DBs Position Unknown AA seq 332 aa AA seqDB search MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTV PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDF EQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG SILASLSTFQQMWISKQEYDESGPSIVHRKCF NT seq 999 nt NT seq  +upstreamnt  +downstreamnt atggtgggtatgggccagaaggactcctacgtgggcgatgaggcccagagcaagaggggc atcctgaccctgaagtaccccatcgagcacggtattgtcaccaactgggacgacatggag aagatctggcatcacactttctacaacgagctgcgtgtggcccccgaggagcacccagtg ctgctgaccgaggcccccctgaaccccaaggccaaccgtgagaagatgacccagatcatg ttcgagaccttcaacaccccggccatgtacgtggccatccaggccgtgctgtccctgtac gcctctggccgcaccaccggcatcgtgatggactccggggacggggtcacccacactgtg cccatctacgaggggtacgccctgccccacgccatcctgcgtctggacctggctggccgg gacctgacggactacctcatgaagatcctcacggagcgcggctacagcttcaccaccacc gccgagcgggaaattgtgcgtgacatcaaggagaagctctgctacgtggccttggacttc gagcaggagatggccaccgccgcgtcctcttcctccctggagaagagctacgagctgccc gacgggcaggtgatcaccatcggcaacgagcggttccgctgccccgaggcgctcttccag ccttccttcctgggcatggaatcctgtggcatccacgaaactaccttcaactccatcatg aagtgcgacgtcgacatccgcaaggacctctacgccaacacggtgctgtctggggggacc accatgtaccccggcatcgctgaccggatgcagaaggagatcaccgccctggcgcccagc acgatgaagatcaagatcatcgcaccccctgagcgcaagtactccgtgtggatcggtggc tccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcaggagtatgac gagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system