Panthera pardus (leopard): 109253856 Help Entry 109253856         CDS       T06062                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism ppad  Panthera pardus (leopard) Pathway ppad01522   Endocrine resistance ppad04010   MAPK signaling pathway ppad04024   cAMP signaling pathway ppad04210   Apoptosis ppad04380   Osteoclast differentiation ppad04620   Toll-like receptor signaling pathway ppad04657   IL-17 signaling pathway ppad04658   Th1 and Th2 cell differentiation ppad04659   Th17 cell differentiation ppad04660   T cell receptor signaling pathway ppad04662   B cell receptor signaling pathway ppad04668   TNF signaling pathway ppad04713   Circadian entrainment ppad04725   Cholinergic synapse ppad04728   Dopaminergic synapse ppad04915   Estrogen signaling pathway ppad04917   Prolactin signaling pathway ppad04921   Oxytocin signaling pathway ppad04926   Relaxin signaling pathway ppad04928   Parathyroid hormone synthesis, secretion and action ppad04932   Non-alcoholic fatty liver disease ppad04935   Growth hormone synthesis, secretion and action ppad05031   Amphetamine addiction ppad05132   Salmonella infection ppad05133   Pertussis ppad05135   Yersinia infection ppad05140   Leishmaniasis ppad05142   Chagas disease ppad05161   Hepatitis B ppad05162   Measles ppad05166   Human T-cell leukemia virus 1 infection ppad05167   Kaposi sarcoma-associated herpesvirus infection ppad05170   Human immunodeficiency virus 1 infection ppad05171   Coronavirus disease ppad05200   Pathways in cancer ppad05207   Chemical carcinogenesis - receptor activation ppad05208   Chemical carcinogenesis - reactive oxygen species ppad05210   Colorectal cancer ppad05224   Breast cancer ppad05231   Choline metabolism in cancer ppad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ppad05323   Rheumatoid arthritis ppad05417   Lipid and atherosclerosis ppad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109253856 (FOS)    04668 TNF signaling pathway     109253856 (FOS)    04024 cAMP signaling pathway     109253856 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109253856 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109253856 (FOS)    04660 T cell receptor signaling pathway     109253856 (FOS)    04658 Th1 and Th2 cell differentiation     109253856 (FOS)    04659 Th17 cell differentiation     109253856 (FOS)    04657 IL-17 signaling pathway     109253856 (FOS)    04662 B cell receptor signaling pathway     109253856 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     109253856 (FOS)    04917 Prolactin signaling pathway     109253856 (FOS)    04921 Oxytocin signaling pathway     109253856 (FOS)    04926 Relaxin signaling pathway     109253856 (FOS)    04935 Growth hormone synthesis, secretion and action     109253856 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     109253856 (FOS)   09156 Nervous system    04725 Cholinergic synapse     109253856 (FOS)    04728 Dopaminergic synapse     109253856 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     109253856 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     109253856 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109253856 (FOS)    05207 Chemical carcinogenesis - receptor activation     109253856 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     109253856 (FOS)    05231 Choline metabolism in cancer     109253856 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109253856 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     109253856 (FOS)    05224 Breast cancer     109253856 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109253856 (FOS)    05170 Human immunodeficiency virus 1 infection     109253856 (FOS)    05161 Hepatitis B     109253856 (FOS)    05171 Coronavirus disease     109253856 (FOS)    05162 Measles     109253856 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     109253856 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     109253856 (FOS)    05135 Yersinia infection     109253856 (FOS)    05133 Pertussis     109253856 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     109253856 (FOS)    05142 Chagas disease     109253856 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     109253856 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     109253856 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109253856 (FOS)    05418 Fluid shear stress and atherosclerosis     109253856 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     109253856 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     109253856 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ppad03000]     109253856 (FOS)    04131 Membrane trafficking [BR:ppad04131]     109253856 (FOS) Transcription factors [BR:ppad03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     109253856 (FOS) Membrane trafficking [BR:ppad04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     109253856 (FOS) SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 CCDC110 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  109253856 NCBI-ProteinID:  XP_019282740 Ensembl:  ENSPPRG00000019513 UniProt:  A0A9V1EJ37 LinkDB All DBs Position Unknown AA seq 381 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYSRAGVVKTVTAGGR AQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSAL QTEIANLLKEKEKLEFILAAHRPACKIPDELGFPEEMSVASLDLSGGLPEAATPESEEAF TLPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFY AADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCGAAHR KGSSSNEPSSDSLSSPTLLAL NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccagccgactccttctccagcatg ggctctcctgtcaatgcgcaggacttctgcacggatctggccgtctccagcgccaacttt atcccaacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggctccttctcagaccagagccccccacccctatggagtccccgcc ccctccgccggggcttactccagggctggagtcgtgaagaccgtgaccgcaggaggccga gctcagagcattggcaggaggggcaaagtggaacagttgtccccagaagaagaagagaaa aggagaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccggaggcgg gagctcacggatacgctgcaagcggagacagaccaactagaggatgagaagtctgctttg cagactgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagct caccgacccgcctgcaagatccccgatgagctgggcttcccggaagagatgtctgtggct tccctagatctgagcgggggcctgccggaagctgccacccccgagtcggaggaggctttc accctgcccctcctcaatgatcctgagcccaagccctccgtggagccggtcaagagcatc agcagcatggagctgaaggccgagccctttgatgacttcctgttcccagcatcgtccagg cccagcggctctgagaccgcccgctctgtgccagacatggacctgtctggttccttctat gcagcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagag ctggagcctctgtgcaccccggtggtcacctgtactcctagctgcactacttacacgtct tccttcgtcttcacctaccctgaggctgactccttccccagctgtggggctgctcaccgc aagggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggcc ctgtga

DBGET integrated database retrieval system