Panthera pardus (leopard): 109263814 Help Entry 109263814         CDS       T06062                                  Symbol IL6 Name (RefSeq) interleukin-6 isoform X1   KO K05405   interleukin 6 Organism ppad  Panthera pardus (leopard) Pathway ppad01521   EGFR tyrosine kinase inhibitor resistance ppad01523   Antifolate resistance ppad04060   Cytokine-cytokine receptor interaction ppad04061   Viral protein interaction with cytokine and cytokine receptor ppad04066   HIF-1 signaling pathway ppad04068   FoxO signaling pathway ppad04151   PI3K-Akt signaling pathway ppad04218   Cellular senescence ppad04620   Toll-like receptor signaling pathway ppad04621   NOD-like receptor signaling pathway ppad04623   Cytosolic DNA-sensing pathway ppad04625   C-type lectin receptor signaling pathway ppad04630   JAK-STAT signaling pathway ppad04640   Hematopoietic cell lineage ppad04657   IL-17 signaling pathway ppad04659   Th17 cell differentiation ppad04668   TNF signaling pathway ppad04672   Intestinal immune network for IgA production ppad04931   Insulin resistance ppad04932   Non-alcoholic fatty liver disease ppad04933   AGE-RAGE signaling pathway in diabetic complications ppad04936   Alcoholic liver disease ppad05010   Alzheimer disease ppad05020   Prion disease ppad05022   Pathways of neurodegeneration - multiple diseases ppad05132   Salmonella infection ppad05133   Pertussis ppad05134   Legionellosis ppad05135   Yersinia infection ppad05142   Chagas disease ppad05143   African trypanosomiasis ppad05144   Malaria ppad05146   Amoebiasis ppad05152   Tuberculosis ppad05161   Hepatitis B ppad05162   Measles ppad05163   Human cytomegalovirus infection ppad05164   Influenza A ppad05166   Human T-cell leukemia virus 1 infection ppad05167   Kaposi sarcoma-associated herpesvirus infection ppad05168   Herpes simplex virus 1 infection ppad05169   Epstein-Barr virus infection ppad05171   Coronavirus disease - COVID-19 ppad05200   Pathways in cancer ppad05202   Transcriptional misregulation in cancer ppad05321   Inflammatory bowel disease ppad05323   Rheumatoid arthritis ppad05332   Graft-versus-host disease ppad05410   Hypertrophic cardiomyopathy ppad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109263814 (IL6)    04668 TNF signaling pathway     109263814 (IL6)    04066 HIF-1 signaling pathway     109263814 (IL6)    04068 FoxO signaling pathway     109263814 (IL6)    04151 PI3K-Akt signaling pathway     109263814 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109263814 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     109263814 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     109263814 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109263814 (IL6)    04620 Toll-like receptor signaling pathway     109263814 (IL6)    04621 NOD-like receptor signaling pathway     109263814 (IL6)    04623 Cytosolic DNA-sensing pathway     109263814 (IL6)    04625 C-type lectin receptor signaling pathway     109263814 (IL6)    04659 Th17 cell differentiation     109263814 (IL6)    04657 IL-17 signaling pathway     109263814 (IL6)    04672 Intestinal immune network for IgA production     109263814 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109263814 (IL6)    05202 Transcriptional misregulation in cancer     109263814 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109263814 (IL6)    05161 Hepatitis B     109263814 (IL6)    05171 Coronavirus disease - COVID-19     109263814 (IL6)    05164 Influenza A     109263814 (IL6)    05162 Measles     109263814 (IL6)    05168 Herpes simplex virus 1 infection     109263814 (IL6)    05163 Human cytomegalovirus infection     109263814 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     109263814 (IL6)    05169 Epstein-Barr virus infection     109263814 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     109263814 (IL6)    05135 Yersinia infection     109263814 (IL6)    05133 Pertussis     109263814 (IL6)    05134 Legionellosis     109263814 (IL6)    05152 Tuberculosis     109263814 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     109263814 (IL6)    05144 Malaria     109263814 (IL6)    05142 Chagas disease     109263814 (IL6)    05143 African trypanosomiasis     109263814 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     109263814 (IL6)    05321 Inflammatory bowel disease     109263814 (IL6)    05332 Graft-versus-host disease     109263814 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     109263814 (IL6)    05020 Prion disease     109263814 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     109263814 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109263814 (IL6)    05410 Hypertrophic cardiomyopathy     109263814 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     109263814 (IL6)    04932 Non-alcoholic fatty liver disease     109263814 (IL6)    04931 Insulin resistance     109263814 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     109263814 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109263814 (IL6)    01523 Antifolate resistance     109263814 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppad04052]     109263814 (IL6) Cytokines and neuropeptides [BR:ppad04052]  Cytokines   Interleukins    109263814 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 GCSF Sec16 DUF4924 IL23 Motif Other DBs NCBI-GeneID:  109263814 NCBI-ProteinID:  XP_019299125 Ensembl:  ENSPPRG00000001365 UniProt:  A0A9V1FB24 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSEAHSALEPTRNERELHLPSRTPAMTFLSTSAFSPLAFSLGLLLVVATAFPTPGPLGGD ATSNRLPLTSADKMEELIKYILGKISALKKEMCDNYNKCEDSKEALAENNLNLPKLAEKD GCFQSGFNQETCLTRITTGLQEFQIYLKFLQDKYEGDKENAKSVYTNTNVLLQMLKRKGK NQDEVTIPVPTVEVGLQAKLQSQEEWLRHTTIHLTLRRLEDFLQFSLRAVRIM NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctgaggctcattctgccctcgagcccaccaggaacgaaagagagctccatctgccc tccaggactccagccatgaccttcctctccacaagcgccttcagtccactcgccttctcc ctggggctgctcctggtggtggctactgctttccctaccccgggacccctgggaggagat gccacctcaaatagactaccactcacctctgcagacaaaatggaagaactcattaagtac atcctcggcaaaatctctgcactgaaaaaggagatgtgtgacaactataacaaatgtgag gacagcaaggaggcactggcagaaaacaacctaaatcttccgaaactggcagaaaaagat ggatgcttccaatctgggttcaatcaggagacctgcctgacaagaatcactactggtctt caggagtttcagatatacctgaaattcctccaggacaagtatgagggtgataaggaaaat gccaagtctgtatacaccaatactaacgtcctgctccagatgctgaagcgtaagggaaag aatcaggatgaggtaaccatccctgtcccaaccgtagaagttggcctgcaggctaagctg cagtcacaggaagagtggctgaggcacacaacaattcacctcaccctgcgaaggctggag gacttccttcagttcagcctcagggctgttcggataatgtaa

DBGET integrated database retrieval system